KEGG   Bacillus sp. 1NLA3E: B1NLA3E_21665Help
Entry
B1NLA3E_21665     CDS       T02643                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00071  Fatty acid degradation
baci00072  Synthesis and degradation of ketone bodies
baci00280  Valine, leucine and isoleucine degradation
baci00310  Lysine degradation
baci00362  Benzoate degradation
baci00380  Tryptophan metabolism
baci00620  Pyruvate metabolism
baci00630  Glyoxylate and dicarboxylate metabolism
baci00640  Propanoate metabolism
baci00650  Butanoate metabolism
baci00900  Terpenoid backbone biosynthesis
baci01100  Metabolic pathways
baci01110  Biosynthesis of secondary metabolites
baci01120  Microbial metabolism in diverse environments
baci01130  Biosynthesis of antibiotics
baci01200  Carbon metabolism
baci01212  Fatty acid metabolism
baci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1NLA3E_21665
   00630 Glyoxylate and dicarboxylate metabolism
    B1NLA3E_21665
   00640 Propanoate metabolism
    B1NLA3E_21665
   00650 Butanoate metabolism
    B1NLA3E_21665
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B1NLA3E_21665
   00072 Synthesis and degradation of ketone bodies
    B1NLA3E_21665
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B1NLA3E_21665
   00310 Lysine degradation
    B1NLA3E_21665
   00380 Tryptophan metabolism
    B1NLA3E_21665
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B1NLA3E_21665
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B1NLA3E_21665
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B1NLA3E_21665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:baci04147]
    B1NLA3E_21665
Enzymes [BR:baci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B1NLA3E_21665
Exosome [BR:baci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B1NLA3E_21665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AGK56071
UniProt: N0B699
Position
complement(4684579..4685766)
Genome map
AA seq 395 aa AA seqDB search
MGKTVILSGIRTPFGKFGGGLSQLTAAELGGIAIKGALEKAQVKPDEVNEVIFGTVLQGG
QGQIPSRQAARNAGLPWEVKTETVNKVCASGMRSVTLADQIIRLGDEEVIVAGGMESMSN
APYLLPKARWGLKMGDAAVTDLMIRDGLSCSFTGAHMGTYGNSTAEELEISREDQDKWAY
RSHKLAVEAIKSGKFAEEIIPVEVPKRKGHPTVIEHDESPRPDTTVEVLAKLGPAFNRAG
TITAGNAPGVNDGAAALVLMSEERAIREGRQPEAIILGHAEVGLEAKDFPKSPGVVIKEL
LKKTGKRVEEIDLFEINEAFAAVALASQKVAGLDPEKINVNGGAVALGHPIGASGARIIL
TLIRELQRRGGGIGIAAICSGGGQGDAIMIEVPKQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggggaagacagtcattttaagcggaatacgaacaccatttggaaagtttggcggaggc
ttaagccaattaacggctgctgagcttgggggaattgccattaaaggggcattagaaaag
gcccaagttaaacccgatgaggtaaacgaagtcatttttggtactgtattgcaaggtgga
caagggcaaatcccatcgcgccaggctgcaagaaacgcaggtctcccatgggaggttaag
actgaaacggttaacaaagtatgtgcatctggaatgcgtagcgttacactcgcggatcag
atcatcagattgggcgatgaggaagtgattgttgcgggtggaatggaatcaatgagtaat
gctccttatttactacctaaggctcgttggggtttaaaaatgggcgatgcagctgttaca
gatttaatgattcgtgacgggttaagctgtagttttaccggtgctcatatggggacttat
ggaaatagtacagctgaggagcttgaaatcagccgtgaggaccaagataaatgggcctat
agaagtcacaaattagccgttgaggccattaagtcaggtaagtttgctgaagaaatcatt
ccagttgaggttccaaaacgtaaggggcacccaacggtcattgaacatgatgaatctcct
cgtcctgatacaacagttgaggtattggcaaaacttggtccagcttttaacagagcagga
acgattacggcaggtaatgcccctggtgtaaacgacggagcagccgctttagtgttaatg
agtgaagagcgggcgatccgagaaggtcgacaaccagaagcgattatccttggtcatgct
gaagtgggcttagaggcaaaagattttccaaaaagtcctggtgtcgtcattaaagaactc
cttaagaaaacaggtaaacgggttgaggaaattgatttatttgaaataaatgaagctttc
gcggctgtcgcgttagcaagccaaaaagttgcgggtcttgatcctgaaaaaatcaatgta
aacggtggagccgtagcgttgggccatccaattggcgcaagcggtgccagaattatttta
acactcattcgcgaattacaacgtcgcggcggtggcattggaattgcagccatctgcagc
ggtggcggccaaggcgacgcaattatgatagaagtacctaagcagtaa

DBGET integrated database retrieval system