KEGG   Bacillus sp. 1NLA3E: B1NLA3E_22165Help
Entry
B1NLA3E_22165     CDS       T02643                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00230  Purine metabolism
baci00250  Alanine, aspartate and glutamate metabolism
baci01100  Metabolic pathways
Module
baci_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B1NLA3E_22165
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B1NLA3E_22165
Enzymes [BR:baci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     B1NLA3E_22165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AGK56171
UniProt: N0B6K5
Position
complement(4789457..4790743)
Genome map
AA seq 428 aa AA seqDB search
MSSVVVVGSQWGDEGKGKITDFLSENAEVIARYQGGNNAGHTIRFNEVTYKLHLIPSGIF
YKEKTSVIGNGMVVDPKALITELAYLHERGVTTENLRISNRAHVILPYHLKLDEVEEARK
GDNKIGTTKKGIGPAYMDKAARCGIRISDLLERDVFEEKLTRNLEEKNRLFERFYETEGF
KIEDILDEYYEYGQQIKQYVCDTSVVLNDALDEGRRVLFEGAQGVMLDIDQGTYPFVTSS
NPVAGGVTIGSGVGPTKISHVVGVCKAYTTRVGDGPFPTELNNEIGHQIREVGREYGTTT
GRPRRVGWFDSVVVRHARRVSGITDLSLNSIDVLTGLDTVKICVAYDYKGEMITEYPASL
KVLSECKPVYEELPGWTEDITSCKSLNELPENARHYLERVSQLTGIPLSIFSVGPDRAQT
NVIFSPWR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagttgtagttgttggctcacagtggggcgatgaaggaaaaggaaaaatcaca
gattttttatcagaaaatgcggaagtgattgcccgctatcaaggtgggaataatgccgga
cacacgattcgttttaatgaagtgacatataaattgcatttaattccatcagggatattc
tataaggaaaaaacaagtgttatcggaaatggaatggtcgttgatcctaaagctctgatt
acagaattggcttatcttcatgaacgtggcgttacaactgaaaatctacgcataagcaat
cgtgctcatgtaattttaccttaccatctcaaattggatgaagtagaggaagcacgtaaa
ggtgacaataaaattggtacaactaaaaagggcattggtccagcttacatggacaaagca
gctcggtgtggaattagaatttctgatctactagaacgtgatgtttttgaagaaaaattg
acacgaaacctcgaagaaaaaaatcgtttatttgagcgtttttatgaaacagaaggcttc
aaaattgaggatattttagatgagtactacgaatatggacagcaaattaagcaatatgtg
tgtgacacttcagttgtattaaatgatgcattagatgaaggtcgccgcgttttatttgaa
ggcgctcaaggggttatgcttgatattgatcaaggtacatatccatttgttacatcctct
aatccagttgccggtggagttacaattggttcaggtgttggaccaacaaaaatcagccat
gttgtaggtgtatgtaaagcttatactacacgtgttggggatggcccgttccctactgag
ttaaacaatgaaattggtcatcaaattcgtgaggttggccgtgagtatggtacaacgaca
ggtagaccacgtcgtgttggttggtttgacagtgttgttgttcgccatgcacgtcgtgta
agtgggattactgatctatccttaaattcaatcgacgtattaactggacttgacacagtg
aagatttgtgtagcttatgattataaaggcgaaatgattacggaatatccagcaagtttg
aaggtattatctgaatgtaagccagtttatgaggaacttccaggttggactgaagatatt
acaagctgtaaatcacttaatgaattaccagaaaacgctcgccactatttagagcgtgtt
tctcaactgactggcatcccgttatccatcttctcagtaggaccggaccgtgcccaaaca
aacgtaattttcagcccatggcgctaa

DBGET integrated database retrieval system