KEGG   Bacillus sp. BS34A: BS34A_00550Help
Entry
BS34A_00550       CDS       T03833                                 

Gene name
metS
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00450  Selenocompound metabolism
bacl00970  Aminoacyl-tRNA biosynthesis
bacl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BS34A_00550 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BS34A_00550 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bacl01007]
    BS34A_00550 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bacl03016]
    BS34A_00550 (metS)
Enzymes [BR:bacl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BS34A_00550 (metS)
Amino acid related enzymes [BR:bacl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BS34A_00550 (metS)
Transfer RNA biogenesis [BR:bacl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BS34A_00550 (metS)
 Prokaryotic type
   Other AARSs
    BS34A_00550 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: CEJ75585
Position
I:45632..47626
Genome map
AA seq 664 aa AA seqDB search
MPQENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQ
QKAEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHKVVIEKVFQKLLDNGDI
YLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKY
ADRLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPENPKHVVYVW
IDALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVF
AHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERIN
YDLANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDHTLTSVAEETVKAYEKAMENMEF
SVALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRSVMYHLAESLRISAVLLQPFLTK
TPEKMFEQLGITDESLKAWDSITAFGQLKDTKVQKGEPLFPRLEAEEEIAYIKGKMQGSA
PAKEETKEEEPQEVDRLPEITIDQFMDVELRVAEVIEAEPVKKADRLLKLQLDLGFEKRQ
VVSGIAKHYTPEELVGKKLVCVTNLKPVKLRGELSQGMILAGEADGVLKVVSIDQSLPKG
TRIK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagaaaacaatacattttacattacaacaccgatttattatccgagcggaaaa
ttacatatcggccatgcatatacgacagtcgcaggagatgcaatggcacgttacaaaaga
ttaaaagggttcgatgttcgctatttaacgggaacggacgagcatggacaaaagatccag
caaaaagctgaacaggaaaacattacacctcaggagtatgtggatcgcgcagcggcagat
attcaaaaactgtggaagcagcttgaaatctcaaacgacgactttatccgcacgacagaa
aaacggcataaagttgtcattgaaaaagtgtttcaaaagcttcttgataacggggacatc
tatcttgatgagtatgaaggctggtacagcatccctgatgaaacgttctacacggaaact
cagctcgttgatattgagcggaatgaaaagggagaggtcatcggcggaaaaagccctgac
agcggtcacccagttgaattgatcaaagaggaatcttatttcttccgcatggggaaatac
gcggatcgtcttctgaaatactatgaagaaaacccgacattcattcagccagaatcacgc
aaaaacgaaatgattaataactttatcaaacctggacttgaggatttggcagtatcacgt
accacttttgattggggcgtgaaggtgccggaaaatccaaagcatgttgtatatgtttgg
attgacgcactatttaactatttaacggcactcggttatgatacagaaaatgatgagctt
tatcaaaaatattggcctgccgatgttcatttagtcggtaaggagattgtacgattccat
actatttactggccaattatgctgatggcgctggatcttccgctgccaaagcaagtattc
gcgcatggctggcttttgatgaaagacggaaaaatgtcgaaatcaaaaggaaacgttgta
gatccggttacattaattgaacgctatggtttagacgaacttcgctattacttgcttcgc
gaagtgccgttcggatcagacggtgttttcacgccggaaggatttgttgagcgaatcaac
tatgatttagcgaatgatttaggaaatctattgaatcgtactgttgcgatgattaataag
tattttgacggacaaatcggttcttacaaaggtgctgttacggaatttgaccatacgctc
acttctgttgctgaagaaacagtgaaagcttatgagaaagcaatggaaaatatggagttc
tcggtagcactttcgactttatggcagctcatcagccgcacaaacaaatacattgatgag
acagctccatgggtgcttgcgaaagatccggcaaaagaagaagaattgcgatcagttatg
tatcatctcgctgaatcattgcgtatttcagcggtactgcttcagccattcttaacaaaa
acacctgaaaaaatgttcgagcagctgggcattactgatgaatctttaaaagcttgggac
agcattacagctttcggccagctgaaagatacaaaagtacaaaaaggcgagccattgttc
cctcgtttagaggcagaagaagaaattgcttacatcaaagggaaaatgcaaggttcagca
ccagcgaaagaagaaacaaaagaagaagagcctcaagaggtcgatcgtttacctgaaatt
acgattgatcaatttatggatgtagagcttcgcgtagctgaggtcattgaggcagagcca
gtgaaaaaagcagaccgtttattgaagctgcagcttgatcttggttttgaaaagcgccaa
gtggtatccggcattgcgaagcattatacgcctgaagagcttgttggaaaaaaactcgtt
tgtgtaacaaatctaaaaccggttaaactcagaggagagctttctcaaggtatgatcctt
gcaggagaagcagacggcgttttaaaggtcgtatctatcgatcagtcgttaccaaaaggc
acaagaattaaataa

DBGET integrated database retrieval system