KEGG   Bacillus sp. BS34A: BS34A_26530Help
Entry
BS34A_26530       CDS       T03833                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00071  Fatty acid degradation
bacl00072  Synthesis and degradation of ketone bodies
bacl00280  Valine, leucine and isoleucine degradation
bacl00310  Lysine degradation
bacl00362  Benzoate degradation
bacl00380  Tryptophan metabolism
bacl00620  Pyruvate metabolism
bacl00630  Glyoxylate and dicarboxylate metabolism
bacl00640  Propanoate metabolism
bacl00650  Butanoate metabolism
bacl00900  Terpenoid backbone biosynthesis
bacl01100  Metabolic pathways
bacl01110  Biosynthesis of secondary metabolites
bacl01120  Microbial metabolism in diverse environments
bacl01130  Biosynthesis of antibiotics
bacl01200  Carbon metabolism
bacl01212  Fatty acid metabolism
bacl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BS34A_26530 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BS34A_26530 (mmgA)
   00640 Propanoate metabolism
    BS34A_26530 (mmgA)
   00650 Butanoate metabolism
    BS34A_26530 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BS34A_26530 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BS34A_26530 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BS34A_26530 (mmgA)
   00310 Lysine degradation
    BS34A_26530 (mmgA)
   00380 Tryptophan metabolism
    BS34A_26530 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BS34A_26530 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BS34A_26530 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BS34A_26530 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacl04147]
    BS34A_26530 (mmgA)
Enzymes [BR:bacl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BS34A_26530 (mmgA)
Exosome [BR:bacl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BS34A_26530 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CEJ78058
Position
I:complement(2530871..2532052)
Genome map
AA seq 393 aa AA seqDB search
MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQQAGVSGDDVEGNVMGMVVQAG
SGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDADILVAGGMESMSN
IPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNTAAKEYAISRREQDEWAL
RSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVDKDEAIRRDTSLDQLAKLAPIYASDG
SITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFSTTGMPAHELAAAPGFAINKL
LKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGARILM
TLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaacagtcattgtaagtgctgcaagaactccatttggcaaattcggcggagtt
ttgaaagaggtgaaagctgctgagcttgggggcattgtgatgaaggaggcgctgcaacag
gctggagtctctggagatgatgtagaaggaaacgtcatgggcatggttgtccaggccggc
tcagggcagataccttcccgtcaagctgcccgtctggcgggaatgccttggagtgtgccg
tcagaaacactgaataaagtctgtgcttccggccttcgcgctgtcactttatgtgatcaa
atgattcgggcgcaggatgcggacatacttgttgcgggggggatggaaagcatgagcaat
attccgtatgccgttcccgccgggcgctggggagcacggatgggggacggcgagcttagg
gacttaatggtgtatgacggattaacgtgcgcatttgacgaggtgcacatggctgttcac
ggaaatacagctgccaaggaatatgcaatctcacgaagagagcaggacgaatgggcgttg
agaagtcatgcaagggcagctaaggccgccgatgaagggaagtttcaggatgaaattgtt
cccgtcaactggatcggtcgaaaaggaaaaccaaacgttgttgataaagatgaagcgatt
cgccgtgacacaagtctggatcagctcgcaaaacttgctccgatttatgcaagtgacggt
tctatcacagccggcaatgctcctggagtcaatgacggagccggcgcgttcgtgctgatg
tctgaggaaaaagctgctgagcttggcaaacggcctctggctacaattcttggtttttca
actacgggaatgccagcgcacgagctggcggcagcgccagggtttgctattaacaagctc
ctgaaaaagaatggtttaactgtccaagatattgacttgtttgaagtaaatgaagctttt
gcttcagttgttttgacatgtgaaaaaatcgtaggtttcgatcttgaaaaagtaaatgtg
aatggcggtgcgatcgcgctcggccacccgatcggcgcgagcggtgcgagaattctcatg
acgcttgtttatgaattaaagcgacggggagggggtctgggcgttgccgctatttgcagc
ggggcagcacagggagacgccgtcttagtgcaggttcattaa

DBGET integrated database retrieval system