KEGG   Bacillus sp. BS34A: BS34A_38810Help
Entry
BS34A_38810       CDS       T03833                                 

Gene name
tagD_1
Definition
(GenBank) glycerol-3-phosphate cytidylyltransferase
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BS34A_38810 (tagD_1)
Enzymes [BR:bacl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     BS34A_38810 (tagD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like FAD_syn
Motif
Other DBs
NCBI-ProteinID: CEJ79232
Position
I:complement(3690310..3690411)
Genome map
AA seq 33 aa AA seqDB search
MLSNEESDTYGMFDLFHYGHMKLLERAKEPGIT
NT seq 102 nt NT seq  +upstreamnt  +downstreamnt
atgttatctaatgaagaaagtgatacgtacggaatgtttgatttatttcactatggacat
atgaagctactggaaagagcaaaagaacctgggattacttaa

DBGET integrated database retrieval system