KEGG   Bacillus sp. BS34A: BS34A_43620Help
Entry
BS34A_43620       CDS       T03833                                 

Gene name
argI
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00220  Arginine biosynthesis
bacl00330  Arginine and proline metabolism
bacl01100  Metabolic pathways
bacl01110  Biosynthesis of secondary metabolites
bacl01130  Biosynthesis of antibiotics
bacl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BS34A_43620 (argI)
   00330 Arginine and proline metabolism
    BS34A_43620 (argI)
Enzymes [BR:bacl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BS34A_43620 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase SHOCT
Motif
Other DBs
NCBI-ProteinID: CEJ79704
Position
I:complement(4159719..4160609)
Genome map
AA seq 296 aa AA seqDB search
MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPINREKIKND
EELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGER
KYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSACDGVHLSLDLDGLDPNDAPGVGTPVV
GGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacgatttcggttattggaatgccaatggatttaggacaagcacgacgcgga
gtggatatgggcccgagtgccatccggtacgctcatctgatcgagaggctgtcagacatg
gggtatacggttgaagatctcggtgacattccgatcaatcgcgaaaaaatcaaaaatgac
gaggaactgaaaaacctgaattccgttttggcgggaaatgaaaaactcgcgcaaaaggtc
aacaaagtcattgaagagaaaaaattcccgcttgtcctgggcggtgaccacagtattgcg
atcggcacgcttgcaggcacagcgaagcattacgataatctcggcgtcatctggtatgac
gcgcacggcgatttgaatacacttgaaacttcaccatcgggcaatattcacggcatgccg
ctcgcggtcagcctaggcattggccacgagtcactggttaaccttgaaggctacgcgcct
aaaatcaaaccggaaaacgtcgtcatcattggcgcccggtcacttgatgaaggggagcgc
aagtacattaaggaaagcggcatgaaggtgtacacaatgcacgaaatcgatcgtcttggc
atgacaaaggtcattgaagaaacccttgattatttatcagcatgtgatggcgtccatctg
agccttgatctggacggacttgatccgaacgacgcaccgggtgtcggaacccctgtcgtc
ggcggcatcagctaccgggagagccatttggctatggaaatgctgtatgacgcaggcatc
attacctcagccgaattcgttgaggttaacccgatccttgatcacaaaaacaaaacgggc
aaaacagcagtagagctcgtagaatccctgttagggaagaagctgctgtaa

DBGET integrated database retrieval system