KEGG   Bacillus sp. OxB-1: OXB_0235Help
Entry
OXB_0235          CDS       T03635                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
baco  Bacillus sp. OxB-1
Pathway
baco00860  Porphyrin and chlorophyll metabolism
baco01100  Metabolic pathways
baco01110  Biosynthesis of secondary metabolites
baco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:baco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OXB_0235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:baco01007]
    OXB_0235
Enzymes [BR:baco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     OXB_0235
Amino acid related enzymes [BR:baco01007]
 Aminotransferase (transaminase)
  Class III
   OXB_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAQ08707
UniProt: A0A0A8JEA9
Position
234790..236094
Genome map
AA seq 434 aa AA seqDB search
MNRTISEQVYAEACEHIVGGVNSPSRSYRAVGGDAPTVMERAEGAYFWDVDGNKYIDYLA
AYGPIITGHAHPHITEAITRAAQTGILYGTPTAHEVKFAKMLKEAMPGMDKVRFVNSGTE
AVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPATLGTPDSAGVPSSIAEEVI
TIPFNDPAAYRDAMEKWGDEIACVLVEPIVGNFGIVEPNEGFLPLVHELAADHGALIVYD
EVITAFRFHYGGAQDMLGLTPDLTALGKIIGGGLPIGAYGGKKEIMEQVAPLGPAYQAGT
MAGNPASIQAGIACLEVLQEPGVYEEMDRLGALLEDGILESARKHGISLTTNRLGGALTL
YFTDVKVENYEQAEATDGEVFGKFFKLMLKNGINLAPSKYEAWFLTTAHTEQDIQDTLLA
VDRSFSELSRLLTD
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaacaatttcagaacaggtctatgcggaagcatgtgaacatatcgtaggcggg
gtgaacagtccttcccgcagttatcgggcagttggaggagatgccccgaccgtcatggaa
cgggcggagggcgcctatttctgggacgtcgacggcaataaatacattgattatctggcg
gcatatggaccgatcatcacaggccacgcccacccgcatattacggaagcgatcacgaga
gcggcgcaaacgggcatcttatacgggactccgacagcccatgaagtgaaattcgcaaaa
atgttgaaggaagcgatgcccggcatggataaagtgcgcttcgtcaattcagggacggag
gcggtcatgacgacgatccgcgtggcccgcgcttatacgggacggacgaagatcatgaag
tttgcgggttgctaccatggccattccgaccttgtcttagttgcggcaggatccggacca
gccacgcttgggacgcccgattccgccggggtcccctcctcgattgccgaggaagtgatc
acaatcccgttcaacgatccagcagcttatcgggacgcgatggagaaatggggagacgag
attgcatgcgtccttgtcgagccgatcgtaggcaacttcgggattgtcgagccgaatgaa
ggcttccttccattggtccatgaactggcggccgatcatggcgcattgatcgtttacgac
gaagtcatcacggcattccgcttccattatggaggagcccaggatatgctcggcttgacg
ccggatttgacggcgctcggaaaaatcatcgggggcggtctcccaatcggggcatatggc
ggcaaaaaagagatcatggagcaagttgctccgctcggccccgcttaccaagccgggacg
atggcaggaaatccagcctcgatccaagcgggcattgcttgcttggaagtattgcaggaa
cctggagtatatgaagaaatggaccgcctaggagctttactggaagacggaattttggaa
tccgcccgcaagcacgggatttcgctgacaacgaaccgattgggcggcgcgcttacttta
tacttcaccgatgtgaaagtggagaactacgaacaagctgaagcgacagatggagaagta
ttcgggaagttcttcaaattgatgttgaaaaacgggattaatctcgctccatccaaatac
gaagcatggttcttgacgacagcccatacggagcaggatatccaggacactttactggca
gtcgaccgttcgttcagcgagttaagccgcctattgaccgattga

DBGET integrated database retrieval system