KEGG   Bacillus sp. OxB-1: OXB_0597Help
Entry
OXB_0597          CDS       T03635                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
baco  Bacillus sp. OxB-1
Pathway
baco00071  Fatty acid degradation
baco00072  Synthesis and degradation of ketone bodies
baco00280  Valine, leucine and isoleucine degradation
baco00310  Lysine degradation
baco00362  Benzoate degradation
baco00380  Tryptophan metabolism
baco00620  Pyruvate metabolism
baco00630  Glyoxylate and dicarboxylate metabolism
baco00640  Propanoate metabolism
baco00650  Butanoate metabolism
baco00900  Terpenoid backbone biosynthesis
baco01100  Metabolic pathways
baco01110  Biosynthesis of secondary metabolites
baco01120  Microbial metabolism in diverse environments
baco01130  Biosynthesis of antibiotics
baco01200  Carbon metabolism
baco01212  Fatty acid metabolism
baco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:baco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OXB_0597
   00630 Glyoxylate and dicarboxylate metabolism
    OXB_0597
   00640 Propanoate metabolism
    OXB_0597
   00650 Butanoate metabolism
    OXB_0597
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OXB_0597
   00072 Synthesis and degradation of ketone bodies
    OXB_0597
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OXB_0597
   00310 Lysine degradation
    OXB_0597
   00380 Tryptophan metabolism
    OXB_0597
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OXB_0597
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OXB_0597
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OXB_0597
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:baco04147]
    OXB_0597
Enzymes [BR:baco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OXB_0597
Exosome [BR:baco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OXB_0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAQ09069
UniProt: A0A0A8JH41
Position
complement(604070..605245)
Genome map
AA seq 391 aa AA seqDB search
MKEVVIVSAKRTAIGTFNGMYENVSTKELAKTVMKAVVEESNVPPEAIDEIIVGNVDQSS
AFSNVGRIASLELGFPEKISAHTVGQNCASGMQALVNGIQAIKSGDAETILVVGTENMSQ
IPHLLKGTRSGYRLGHHQVTDKIVEMLHDPFVDMTMGETAEVVAEEHGITREEQDAFALR
SHERALQAQRDGIFAKEIVPVTATKRKETVTLEEDQGPNERTSLEVLSSLRTAFKKDGTI
TAGNACGLNDGAAAMLIMSREKADELGVKPIARIVANASVGVDPKRMGLGPAYAVPKVLE
KAGLTMEDIDLVELNEAFAAQALACVKQLELDLEKVNPFGGAIALGHPVGATGLRLIVTL
LNGLEHFEKKRGIATLCVGGGIGGAVIVERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagtcattgtcagtgccaaacgaacagcgatcggcacgtttaatgggatg
tacgaaaatgtctcgaccaaagaattggccaaaacggtaatgaaagcagtagtcgaagaa
agcaacgtgccacctgaagcaattgacgaaatcattgtcggaaatgtagatcaatcctcc
gcattctcgaatgtcggtcgaattgcctctttggaattggggttccctgaaaagatttcg
gcccatacagttggacaaaactgtgcttccggcatgcaagccttggtaaatggcatccag
gcgatcaaatcgggagatgcggaaacaattctcgtcgttggtacagaaaatatgagccaa
atcccgcatttattaaaagggacccggtctggctatcggctaggtcaccatcaagtaacc
gataagattgtggaaatgctccatgacccgtttgtcgatatgacgatgggggaaacggcg
gaagtggtggcggaagaacacggcattacacgggaagagcaagacgcctttgcacttcgt
agtcacgagcgggcattgcaagcgcagcgggacggcatttttgcaaaagaaattgttcct
gttactgcgacaaagcgaaaagaaactgtgacgttggaagaagaccaagggccaaatgaa
cgaacatcccttgaagtgctttcctctttgcggacggctttcaaaaaggacggaacgatc
actgctggcaatgcgtgcggactaaatgacggagccgcggctatgctgatcatgtccagg
gaaaaagcagatgaacttggggtcaagccgattgcccggattgtggcgaacgcttcagtc
ggggttgatccgaaacggatgggcttgggaccagcttatgccgtgccgaaagttttggaa
aaggcaggcttaacgatggaagacattgacctcgtcgaactgaatgaggcgtttgctgca
caagcgcttgcttgtgtgaagcagttggagcttgatctggaaaaagtgaatcctttcggt
ggggccatcgcgttggggcatcccgtcggagcgaccggcctgcgtctgatcgtcacttta
ctgaacggtttggaacactttgaaaaaaaacgcggtatcgccacgttgtgtgtcgggggt
ggcatcggcggcgcggtcatcgttgagagagtatag

DBGET integrated database retrieval system