KEGG   Bacillus sp. OxB-1: OXB_1097
Entry
OXB_1097          CDS       T03635                                 

Definition
(GenBank) aldoxime dehydrates
  KO
K10566  phenylacetaldoxime dehydratase [EC:4.99.1.7]
Organism
baco  Bacillus sp. OxB-1
Pathway
baco00460  Cyanoamino acid metabolism
baco00643  Styrene degradation
baco01100  Metabolic pathways
baco01110  Biosynthesis of secondary metabolites
baco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:baco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    OXB_1097
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    OXB_1097
Enzymes [BR:baco01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.7  phenylacetaldoxime dehydratase
     OXB_1097
SSDB
Motif
Pfam: Dehydratase_hem DUF4188
Other DBs
NCBI-ProteinID: BAQ09569
UniProt: A0A0A8JIJ3
Position
1123798..1124853
AA seq 351 aa
MKNMPENHNPQANAWTAEFPPEMSYVVFAQIGIQSKSLDHAAEHLGMMKKSFDLRTGPKH
VDRALHQGADGYQDSIFLAYWDEPETFKSWVADPEVQKWWSGKKIDENSPIGYWSEVTTI
PIDHFETLHSGENYDNGVSHFVPIKHTEVHEYWGAMRDRMPVSASSDLESPLGLQLPEPI
VRESFGKRLKVTAPDNICLIRTAQNWSKCGSGERETYIGLVEPTLIKANTFLRENASETG
CISSKLVYEQTHDGEIVDKSCVIGYYLSMGHLERWTHDHPTHKAIYGTFYEMLKRHDFKT
ELALWHEVSVLQSKDIELIYVNCHPSTGFLPFFEVTEIQEPLLKSPSVRIQ
NT seq 1056 nt   +upstreamnt  +downstreamnt
ttgaaaaatatgccggaaaatcacaatccacaagcgaatgcctggactgccgaatttcct
cctgaaatgagctatgtagtatttgcgcagattgggattcaaagcaagtctttggatcac
gcagcggaacatttgggaatgatgaaaaagagtttcgatttgcggacaggccccaaacat
gtggatcgagccttgcatcaaggagccgatggataccaagattccatctttttagcctac
tgggatgagcctgaaacatttaaatcatgggttgcggatcctgaagtacaaaagtggtgg
tcgggtaaaaaaatcgatgaaaatagtccaatcgggtattggagtgaggtaacgaccatt
ccgattgatcactttgagactcttcattccggagaaaattacgataatggggtttcacac
tttgtaccgatcaagcatacagaagtccatgaatattggggagcaatgcgcgaccgcatg
ccggtgtctgccagtagtgatttggaaagcccccttggccttcaattaccggaacccatt
gtccgggagtctttcggaaaacggctaaaagtcacggcgccggataatatttgcttgatt
cgaaccgctcaaaattggtctaaatgtggtagcggggaaagggaaacgtatataggacta
gtggaaccgaccctcataaaagcgaatacgtttcttcgtgaaaatgctagtgaaacaggc
tgtattagttcaaaattagtctatgaacagacccatgacggcgaaatagtagataaatca
tgtgtcatcggatattatctctccatggggcatcttgaacgctggacgcatgatcatcca
acacataaagcgatctacggaaccttttatgagatgttgaaaaggcatgattttaagacc
gaacttgctttatggcacgaggtttcggtgcttcaatccaaagatatcgagcttatctat
gtcaactgccatccgagtactggatttcttccattctttgaagtgacagaaattcaagag
cctttactgaaaagccctagcgtcaggatccagtga

DBGET integrated database retrieval system