KEGG   Bacillus sp. OxB-1: OXB_2799Help
Entry
OXB_2799          CDS       T03635                                 

Definition
(GenBank) glycine cleavage system aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
baco  Bacillus sp. OxB-1
Pathway
baco00260  Glycine, serine and threonine metabolism
baco00630  Glyoxylate and dicarboxylate metabolism
baco00670  One carbon pool by folate
baco01100  Metabolic pathways
baco01110  Biosynthesis of secondary metabolites
baco01130  Biosynthesis of antibiotics
baco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OXB_2799
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OXB_2799
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    OXB_2799
Enzymes [BR:baco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     OXB_2799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: BAQ11270
UniProt: A0A0A8JKY5
Position
complement(2864642..2865739)
Genome map
AA seq 365 aa AA seqDB search
MAEGLKRTALFDSYKEYGGKTIDFGGWELPVQFSGIKAEHEAVRTKAGLFDVSHMGEVVV
SGDGALSYLQKLVTNDVSKLKTGQAQYTVMCYDDGGTIDDLLIYKRDENDYFLVVNASNI
EKDVDWLKQHATDDVTVDDQSASFALLALQGPAAQTVLQRLTDEPLEEIKFFRFKDNVDV
DGHSVMISRTGYTGEDGFEIYGSPDAIVALWPAILEAGAEEGIVPAGLGARDTLRFEAGL
PLYGQELSKDISPLEAGLGFVVKTNKEADFIGKSALVQQKEHGAPRKLIGIEMIDKGIPR
TGYKVFLDDEEIGEVTTGTQSPTLKKNIGFALLKSEHTAEGTEVFVEIRNKRLKAVIIAT
PFYKR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaaggattaaaacggactgctctttttgacagctataaagagtacggcggcaag
acaattgattttggcggatgggagctgcctgtccaattttcgggcatcaaagcggaacat
gaggctgttcggacgaaagccgggcttttcgatgtttcccatatgggggaagtcgtcgta
agcggggacggggctctgtcttatttacagaaacttgtgacgaatgatgtttccaagttg
aaaacaggccaagcgcaatacactgtaatgtgttacgacgatggcggtacgattgacgat
cttctcatttacaagcgtgacgaaaatgattacttcctcgtcgtgaatgcgtctaacatt
gaaaaagacgtggattggctgaagcagcatgcgaccgatgatgtgacggtcgatgaccag
tccgcttcctttgccttattggcgctgcaagggcccgctgctcaaacggtgcttcaaagg
ttgacggatgaaccgttggaagagatcaaattcttccggttcaaagacaatgttgacgta
gacgggcattcggtcatgatttcgcggaccggatatacgggagaggatggatttgaaatc
tatggttcccctgatgcgatcgtagccctgtggccggcaatcctggaagctggagcggaa
gaagggatcgttccagctggtttgggagcaagggacaccttgcgttttgaagccggcttg
ccattatatgggcaggagctgtcaaaagacatctccccattggaagcggggctcggcttt
gtcgtcaaaacgaataaggaggcagacttcattgggaaatctgcactcgtccaacaaaaa
gaacacggtgcaccacggaaactgatcggaatagaaatgatcgataaaggaatcccgcgc
acggggtataaagtgtttttggacgatgaagagatcggtgaagtgacaacgggtacccaa
tcgccgacattgaaaaagaatatcggcttcgctttattgaaaagcgaacacactgccgaa
gggactgaagtgtttgtcgaaattcggaataagcgcctcaaagcagtcattattgcaaca
ccgttttacaaacgataa

DBGET integrated database retrieval system