KEGG   Bacillus sp. OxB-1: OXB_3132Help
Entry
OXB_3132          CDS       T03635                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
baco  Bacillus sp. OxB-1
Pathway
baco00970  Aminoacyl-tRNA biosynthesis
baco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baco00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OXB_3132
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:baco03029]
    OXB_3132
Enzymes [BR:baco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     OXB_3132
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     OXB_3132
Mitochondrial biogenesis [BR:baco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    OXB_3132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAQ11601
UniProt: A0A0A8JMA5
Position
complement(3122774..3124162)
Genome map
AA seq 462 aa AA seqDB search
MINYETIRELKTKFEKKEVSPVEVTKQMLNRIHQFKDLNAFITVNETQALKQAELSEKKY
ALGEQIGFLEGIPISYKDNLSTAGLRTTSGSHIDESLVPMKNAGIVEILQNEGAVNLGKT
NMHEFAFGITSNNPFYGPAKNPWNPEYTPGGSSGGSGVAVAASLGVASIGTDTGGSIRIP
AAACGVVGLKATHDLIDSTGVKNISWTLDHVGPLVKNMDDLAFMMEAMTGEDFSTFLNED
IRGLRIGVPNNYLNERMDDETAALYEKSLEQLTSLGAVLIEVDIPFSNDDLGLLTVLAVS
EAGYVHDAYIDKPESRFGADVEAVLKSSRDISALQYMQALKRKEDLLAQFEELFTKVDVI
VSPVTPSSSQKVGVDELTIHGQTEDIFSGMIRYPSVFNMTGQPALSVPLGLGANDLPVGL
QFAAASYCEPILMRAGFAYEQNFLKEFYAKRDQLLAAAPTLS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaattatgagactattcgtgaattgaaaaccaagtttgagaaaaaagaggtttct
cctgttgaagtgacgaagcagatgttgaaccgcatccatcaattcaaagacctgaacgct
tttattaccgtcaatgaaacgcaagctttgaagcaagcggaactatcggaaaagaaatat
gcgctaggcgaacaaatcgggttcctggaaggaattccgatctcgtataaagataatttg
tctacagccggtttgcggacgacgagcgggtcgcatatcgacgagtcgctcgttccgatg
aaaaacgccggtatcgtggaaatccttcaaaatgaaggggcggtcaatctcggaaagacg
aatatgcatgaattcgcattcggtatcacgtcgaacaatccgttctacggcccagccaaa
aatccttggaacccggagtatacgccgggaggatccagcgggggatccggtgtcgcggtg
gccgcttcgcttggtgtcgcatcgatcggcacggatacaggtggatccattcggattccg
gcagctgcctgcggcgtagtcggattgaaggcaacgcatgacctgatcgactctacaggc
gtgaagaatatttcctggacgctcgaccatgtcggaccgctcgtgaaaaatatggacgat
ctggccttcatgatggaagcgatgacaggggaagacttttcgacattcctgaatgaggac
atccgaggattgcggattggcgtgccgaataattatctaaatgaacggatggatgatgaa
accgctgccttgtatgaaaaatcactcgaacagttgacttcattaggggccgtgctgatc
gaagtggatatcccattctcgaacgacgatctgggacttctgacagtgcttgccgtatcg
gaagcgggttatgtccatgacgcctatatcgataagccggaatcccgcttcggagcggat
gtcgaagccgtcctgaaatcgagccgtgatatttccgcattgcagtacatgcaggcgttg
aagagaaaagaggatttgctagcgcaattcgaagaactgtttacgaaagtggatgtcatc
gtatccccggtgacaccgtcgtcctcacaaaaagtgggggtggacgaattgacgattcac
gggcaaaccgaagatattttcagcggcatgatccgctatccttccgtattcaatatgacg
ggacaaccggccttgtccgtgccgcttggcttaggggcaaatgacttgccggtcggtctt
cagttcgccgcagcttcttactgtgagccgatcctcatgcgtgcaggttttgcgtatgaa
cagaatttcctgaaggagttttacgccaaacgtgatcaactgcttgctgcggctccgact
ttgtcttaa

DBGET integrated database retrieval system