KEGG   Bacillus sp. Pc3: SB24_07605Help
Entry
SB24_07605        CDS       T03544                                 

Definition
(GenBank) sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bacp  Bacillus sp. Pc3
Pathway
bacp00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SB24_07605
Enzymes [BR:bacp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     SB24_07605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2 ARD
Motif
Other DBs
NCBI-ProteinID: AJC25043
Position
complement(1625427..1625930)
Genome map
AA seq 167 aa AA seqDB search
MTISKHDVNAYYQKAGIVLTDNEVEDIQIMDYGLGKLEETGLQLFIYVNTDRYCSKELVL
FPRQTCPEHRHPPVGGEKGKQETFRCRWGKVYLYVEGEKTENPSVLPPEDDKEYYTVWHE
IVLEPGGQYTIPPDTKHWFQAGEEGAVVTEMSSTSTDDHDIFTDPRI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacgatatcgaaacatgatgtgaatgcatactatcaaaaagcgggaatcgttctgact
gataatgaagtcgaagacattcaaatcatggattacggcttaggcaagcttgaggaaacc
gggcttcagctgtttatttacgtgaataccgaccgctactgttcgaaagaattggtgctc
ttcccgcgccagacgtgtccggaacaccgccatccgccggtcggcggcgagaagggaaaa
caagagacattccgctgccgctgggggaaggtgtatctctacgtggaaggcgaaaagaca
gagaacccaagcgtcctcccgccggaagatgacaaggaatactacaccgtctggcatgag
attgtgcttgagccgggcggacaatacaccattccgccggatacaaagcattggtttcaa
gcgggagaagaaggggcggtcgtcacggaaatgtcatcgacaagcacggatgatcacgac
attttcaccgacccgcgcatttaa

DBGET integrated database retrieval system