KEGG   Bacillus sp. Pc3: SB24_10175Help
Entry
SB24_10175        CDS       T03544                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bacp  Bacillus sp. Pc3
Pathway
bacp00220  Arginine biosynthesis
bacp00330  Arginine and proline metabolism
bacp01100  Metabolic pathways
bacp01110  Biosynthesis of secondary metabolites
bacp01130  Biosynthesis of antibiotics
bacp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SB24_10175
   00330 Arginine and proline metabolism
    SB24_10175
Enzymes [BR:bacp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SB24_10175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AJC25492
Position
2138200..2139090
Genome map
AA seq 296 aa AA seqDB search
MNKNISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYAVEDLGDIPVNREKLKND
EELKNLNSVLSGNEQLAQKVDSVIENERFPLVLGGDHSIAIGTLTGTAKHYKQLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGVGHDTLVNLGGYAPKIKPENVVIIGARSLDEGER
EYIKETGMKVYTMHEIDRLGMTKVIEETIDYLSDCDGVHLSLDLDGLDPSDAPGVGTPVV
GGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaatatctcagttattggaatgccgatggatttaggacaagcacgacgcgga
gtggacatgggcccgagcgccatccgctacgcgcatctcattgaacggttatctgacatg
gggtatgcggtggaagacttaggcgacatccccgtcaatcgtgaaaaactcaaaaatgat
gaagagctgaaaaatctgaactctgtgctctcggggaacgagcagctcgcccaaaaggtg
gacagcgtcattgagaatgagcggttccctctcgtcttgggcggcgatcacagcatcgcg
atcggaacgctgacaggaacggcaaagcactataaacagctcggcgtcatctggtacgac
gcgcacggcgacttaaacacgctggaaacatcgccgtcaggcaatattcacggaatgccg
ctggccgtcagcctcggcgtcgggcacgacacgctggtgaacctgggcgggtatgccccg
aaaatcaagccggagaacgtcgtcatcatcggcgcgagatcgcttgatgaaggtgagcgt
gaatacattaaggaaacaggcatgaaggtctatacgatgcatgagattgaccgcctcggc
atgacaaaggtcattgaagaaaccattgactacttgtcagactgtgacggcgttcatctc
agccttgacctcgacggccttgatccgagcgacgcacccggcgtaggcacacctgtcgtc
ggcggcatcagctaccgtgaaagccatttggcaatggagatgctgtatgatgccgacatc
atcacttcagctgaatttgtcgaagtcaacccgatcctcgatcacaaaaacaaaaccggc
aaaacagcggtcgagctggtggaatctttgttaggaaaaaaactgttataa

DBGET integrated database retrieval system