KEGG   Bacillus sp. Pc3: SB24_13550Help
Entry
SB24_13550        CDS       T03544                                 

Definition
(GenBank) oxalate decarboxylase
  KO
K01569  oxalate decarboxylase [EC:4.1.1.2]
Organism
bacp  Bacillus sp. Pc3
Pathway
bacp00630  Glyoxylate and dicarboxylate metabolism
bacp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SB24_13550
Enzymes [BR:bacp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.2  oxalate decarboxylase
     SB24_13550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_1 Cupin_2 Cupin_3 AraC_binding MannoseP_isomer 3-HAO ARD Cupin_4 GPI BiPBP_C
Motif
Other DBs
NCBI-ProteinID: AJC26132
Position
complement(2849186..2850346)
Genome map
AA seq 386 aa AA seqDB search
MSKENNCNIPQPIRGDKGATVTIPRNLERDRQNPDMLTPPETDHGTVDNMKFSFSDVHNR
LEKGGYAREVTVRELPISENLASVNMRLKPGAIRELHWHKEAEWAYMLTGKARVTIVDEQ
GRSFIDDVKEGDLWYFPSGLPHSIQALKEGCEFLLVFDDGSFSENSTFQVTDWLAHTPLD
VIASNFGVSEKDLAGLPGKEKYIFEEPVPGKLKDDIVEGPNGEVPYPFTYRLLDEGPTAE
TDGGKVYIADSTNFKVSKTIASALVVVEPGAMRELHWHPNTHEWQYYISGKGRMTVFASD
GHARTFNYQAGDVGYVPFAMGHYVENLGDEPLVFLEIFKDDHYADVSLNQWLAMLPEKFV
QQHLDLGKDFTDILSKEKHPVVKKKC
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaaacaactgcaatatcccgcagccgatcagaggagacaaaggggcgacc
gtcacgattccgcgcaaccttgaaagagaccgccaaaatccggatatgctgacgccgccg
gaaacggatcacggcacagtggataatatgaaattctctttctcagatgtgcacaaccgg
ctggaaaagggcggatacgcgcgtgaggtgaccgttcgcgagctgccgatttctgagaat
ctggcatctgtcaacatgcgtttaaaaccgggcgccatccgtgagctgcactggcataaa
gaagcggaatgggcatatatgctgacgggcaaagcgcgggtcacgattgttgatgaacag
ggacgcagttttatcgatgacgtgaaggaaggagatctgtggtacttcccgtcaggcctg
ccgcactccattcaggcgctgaaagaaggctgtgaattcctcttggtttttgatgacggt
tctttctcagaaaacagcacattccaagtgactgactggcttgcccacacaccgcttgat
gtcattgccagcaacttcggggtttcagaaaaagacctcgccggcctgcccgggaaagaa
aaatatatctttgaagagccggttcccgggaagctgaaagatgacattgtggaaggcccg
aacggtgaagtgccttatccgttcacttaccgcctgctggatgaaggtccgactgctgag
acggatggcggcaaagtatatatcgcggattccacaaacttcaaagtgtccaaaacgatc
gcttcagcgcttgtcgtggtcgaaccgggcgcaatgagagagctgcactggcatccgaac
acgcatgaatggcagtattatatttccggtaaagggcggatgacggtttttgcatcggac
ggccatgcaagaacatttaactatcaggccggggatgtcggttacgttccgttcgcaatg
ggccactatgtggagaatttgggagatgagccgctcgtcttcctggaaatcttcaaggat
gaccactatgccgatgtgtccctgaaccaatggcttgccatgcttcctgagaaattcgtc
cagcagcatctggatctgggcaaagactttacggatattctttcgaaagagaaacaccct
gtcgtcaaaaagaaatgctga

DBGET integrated database retrieval system