KEGG   Bacillus sp. Pc3: SB24_14675Help
Entry
SB24_14675        CDS       T03544                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K11440  choline dehydrogenase [EC:1.1.1.1]
Organism
bacp  Bacillus sp. Pc3
Pathway
bacp00260  Glycine, serine and threonine metabolism
bacp01100  Metabolic pathways
Module
bacp_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SB24_14675
Enzymes [BR:bacp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SB24_14675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: AJC26343
Position
3070102..3071310
Genome map
AA seq 402 aa AA seqDB search
MTLNMKVESMHKFHTFEIPTVIKHGIGAIQHAGSEVRALGVTKALLVTDPGIYNAGVANP
VIESLQEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVE
ATHEGSVLDYEAAEGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPL
IAAHLTVIDPELHTSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYI
KRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGP
VMEYNWKGYPEKFARIAKAFGINTSNMTTEEAAKASVNWMYDLVKDLEVPSLEEQGVSPD
MIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFDLTPKTV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacattaaatatgaaagtagaaagcatgcataaattccatacattcgaaatcccgaca
gtcattaaacacggaatcggtgcgattcagcacgcgggaagtgaagtcagagcgcttggc
gtcacaaaagcgctgctcgtaacagacccgggaatttataacgcgggagtggcaaacccg
gtcattgaatctttacaggaagcgggcatcgaagtcgtcctgtttaacaaagtggagccg
aacccgcctgtacgtcttgtaaacgaaggatcagaactgtataaaaaagaaaactgcaac
ggtcttgtggctgtcggcggcggaagctccatggatacagcgaaagcgatcggggtagaa
gcgacacacgaaggaagcgtgcttgattatgaagccgcggaaggcaaaaagccgctggaa
aaccgtattcctccgctgacaacgatcccgacgactgcgggaacaggttcagaggtcaca
caatgggcggtcattacagatgaggaaagagaatttaaattcaatacgggcggaccgctt
atcgccgcgcatttaacggtcattgaccctgagctgcacacgtccatgcctccgcatgtg
acggccatgacaggtattgacgcacttgcgcacgccatcgagtgctatacgatgaaattc
gcgcagccgatcactgatgccgttgctttaatggccattgaatatgcggcgcattatatt
aagcgcgcgtttgcggacggagaggatttggaagcaagatacggcatggcgcaggcggcg
atgcttgccggcctttcatacggcagtgaatcagcaggcgcggcgcatgcgatgagccag
acgctcggcggcatcatccctgtcgctcacggacaatgcgtcgcagctatgatggggccg
gtaatggaatacaactggaaaggctatccggaaaaattcgcccgcatcgccaaagcattc
ggaatcaatacaagcaacatgacaaccgaagaagcggcaaaagcgtccgtcaactggatg
tatgatcttgtaaaagatttagaggtgccgagtttagaagaacaaggtgtgtctccggac
atgattgaacgtttatcaaaagaagccatgaaagatccgcaaactttcggaaatccaaga
gatttgaatgagaaagcatacaactggatttacaaacgctgctttgacttaacgccgaaa
acggtataa

DBGET integrated database retrieval system