KEGG   Bacillus sp. Pc3: SB24_17500Help
Entry
SB24_17500        CDS       T03544                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bacp  Bacillus sp. Pc3
Pathway
bacp00071  Fatty acid degradation
bacp00072  Synthesis and degradation of ketone bodies
bacp00280  Valine, leucine and isoleucine degradation
bacp00310  Lysine degradation
bacp00362  Benzoate degradation
bacp00380  Tryptophan metabolism
bacp00620  Pyruvate metabolism
bacp00630  Glyoxylate and dicarboxylate metabolism
bacp00640  Propanoate metabolism
bacp00650  Butanoate metabolism
bacp00900  Terpenoid backbone biosynthesis
bacp01100  Metabolic pathways
bacp01110  Biosynthesis of secondary metabolites
bacp01120  Microbial metabolism in diverse environments
bacp01130  Biosynthesis of antibiotics
bacp01200  Carbon metabolism
bacp01212  Fatty acid metabolism
bacp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SB24_17500
   00630 Glyoxylate and dicarboxylate metabolism
    SB24_17500
   00640 Propanoate metabolism
    SB24_17500
   00650 Butanoate metabolism
    SB24_17500
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SB24_17500
   00072 Synthesis and degradation of ketone bodies
    SB24_17500
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SB24_17500
   00310 Lysine degradation
    SB24_17500
   00380 Tryptophan metabolism
    SB24_17500
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SB24_17500
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SB24_17500
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SB24_17500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacp04147]
    SB24_17500
Enzymes [BR:bacp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SB24_17500
Exosome [BR:bacp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SB24_17500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: AJC26852
Position
3607138..3608319
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAAISESEAEGAVMGMVVQAG
AGQIPARQAARYAGLPWSVPAETINKVCASGLRAVTICDQMIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSTAAKKYGISRDEQDHYAL
LSQKRAAEAAEAGKLREEIVPVTWTGKKGKQHTVEADEGLRPDTSLEQLAALKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LTKTGLTVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGIAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggcaagaacgccgttcggaaaatttggcggcgca
ttaaaagaggtaaaggcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccgctatcagtgaaagcgaagcggaaggagcggtgatgggaatggtcgtccaggcgggt
gccgggcagataccggcacggcaggctgcaagatatgccgggcttccgtggtccgttccg
gctgaaaccattaataaggtctgtgcatcggggctcagggccgttaccatctgtgatcaa
atgatccgggcgaaagatgcggacgtgctgattgcaggcggaatggaaagcatgagcaat
attccgtacgccattccggccggccgctggggtgtgaggatgggagacggggtgtttcag
gatttaatggttcatgacgggctgacctgtgcgttcgaccaggtgcatatggctgtccac
ggaagcactgcggccaaaaagtacggcatttcccgggatgaacaggatcattacgctctt
ttgagtcagaaacgcgcggctgaggcggccgaggcgggcaaattgcgtgaagaaattgtc
cccgtcacctggaccggcaaaaagggcaaacagcataccgttgaagcggatgaggggctg
cgccctgatacgagccttgagcagcttgcagcgctcaagccaatttttacagccgacgga
acggttacagccggaaacgctcccggtgtaaatgacggggccggagcatttgtgctgatg
tcagaggaaaaagccgcgaagcagcatgtcaggccgctcgcagcgatacttggctttgcg
tcagtcggactggaagcgtccgagctggcaagcgcgccgggagaggccatcagccggctc
ttgacaaaaaccggactgaccgttgacgatattgatttgtttgaagtaaatgaagcattt
gcgtccgtcgtgctcgtgagtgaaaaaatagccgggttcagccgggaaaaagtgaatgta
aacggaggggcgattgcgttcggccacccgatcggcgcaagcggagcgagaatcatcatg
agtttaatatacgaattaaagcgtcgcggaggaggtttaggcatagctgctatatgcagc
ggagcggctcaaggagatgccgtcctgcttgaggtgtactga

DBGET integrated database retrieval system