KEGG   Bacillus sp. Y1: DOE78_00240Help
Entry
DOE78_00240       CDS       T05922                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bacq  Bacillus sp. Y1
Pathway
bacq00450  Selenocompound metabolism
bacq00970  Aminoacyl-tRNA biosynthesis
bacq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DOE78_00240
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DOE78_00240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bacq01007]
    DOE78_00240
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bacq03016]
    DOE78_00240
Enzymes [BR:bacq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DOE78_00240
Amino acid related enzymes [BR:bacq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DOE78_00240
Transfer RNA biogenesis [BR:bacq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DOE78_00240
 Prokaryotic type
   Other AARSs
    DOE78_00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c Zn-ribbon_8 Use1 zinc-ribbons_6 DNA_ligase_ZBD
Motif
Other DBs
NCBI-ProteinID: AYA74032
UniProt: A0A385NIN9
Position
45153..47111
Genome map
AA seq 652 aa AA seqDB search
MGEKRKTFYLTTPIYYPSGNLHIGHAYTTVAGDAMARYKRLRGFDVMYLTGTDEHGQKIQ
RKAEETGITPQAYVDDIVAGIQELWKKLDISYDDFIRTTQDRHKTVVEKIFSQLLEQGDI
YLDQYEGMYCTPCESFFTERQLNEGNCPDCGRPVEKVKEESYFFKVSKYADRLLQYYEEN
PGFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPGNPKHVIYVWIDALSNYITAL
GYGTEDASKYETYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGK
MSKSKGNVVDPVTLIDRYGLDSLRYYLLREVPFGADGVFTPEGFVERINFDLANDLGNLL
NRTVAMINKYFDGTIPMYQGSKREYEVQLLQVNEETVKKYEEAMEKMEFSVALTALWQLV
SRTNKFIDETSPWALAKDEEKNDELASVMVHLAETLRRVAILLQPFLTKTPKEIFKQLSI
VDSSLQSWESLGKFGMIPEGTKVEKGEPIFPRLDIQEEVSFIKEKMQSTAKPAVEEPKTE
EIPEVEEITIDDFMKVDLRVAQVVEAEPIKKADKLLKLQLDLGFERRQVVSGIAQFYKPE
ELVGQRVICVTNLKPVKLRGELSQGMILAGQKDGIMSLATVSDSLPLGAKVK
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgagaaaagaaagacattttatttaacaacaccaatttattatcctagtggaaac
ttacatattggacatgcatatacaacagtagctggagatgcgatggctcgttataagagg
ttacgtgggtttgatgtcatgtatttaacgggtacggatgaacatggtcagaaaattcaa
cgcaaggctgaggaaacaggaattactcctcaagcatacgttgacgatattgtagctgga
attcaggaactctggaagaagcttgacatttcgtatgatgattttattcggacgacacaa
gacagacataaaacagtggttgagaaaatattttctcagcttcttgagcaaggtgatatt
tatcttgatcaatacgaaggaatgtactgtactccctgtgaatctttctttactgaaaga
caattaaatgaaggaaattgccctgactgtggtagacctgtagaaaaggtgaaagaagaa
tcttacttctttaaagtaagtaagtatgctgatcgtttattgcaatactatgaagaaaac
cctggatttatccaacctgagtcccgtaaaaatgagatgattaataactttattaaacca
ggattagaggatcttgctgtatcgagaacgacgtttgattggggtgttaaggtaccaggt
aatcctaaacatgttatttatgtttggattgatgctttgtcaaattatattactgcttta
ggctacggcaccgaggatgcttctaaatatgaaacctattggccagcggacgtacattta
gttggtaaggagatcgttcgtttccatactatctattggccaattatgctcatggcacta
gaccttccactccctaaaaaagtgttcgctcacggttggcttctcatgaaagatggaaaa
atgtctaagtctaaagggaatgtggtagatccagtaacattaattgatcgttatggactt
gattccctacgttactacttattaagagaagttccatttggagcagatggagtctttaca
cctgaagggtttgttgaaagaattaactttgatttagcgaatgatttaggaaacctattg
aatcgtacagttgctatgatcaataagtattttgatggaacgattccgatgtaccaaggt
tcaaagagagaatacgaggtacagcttctccaagtaaatgaggaaactgtgaaaaagtat
gaagaagcaatggagaagatggagttttctgttgctcttacagcactttggcagttagtt
agccgaacaaataaatttattgatgaaacatcaccttgggctttagcaaaagacgaggag
aaaaatgatgaattagcaagtgttatggttcatttagctgaaacacttcgacgagtggct
attttgcttcaaccattcctaacaaagacaccaaaagaaatatttaaacagctttctatt
gtagatagtagtcttcagtcctgggaaagtctcgggaaatttgggatgattccagaaggt
acaaaggtggagaaaggtgaacctattttcccaagacttgatatccaagaagaggtgtct
tttattaaagaaaaaatgcaatcgactgcgaagcctgctgtagaagaaccaaaaacagaa
gaaattccagaggttgaggaaatcacgattgatgactttatgaaggttgacttgcgagta
gcacaagtagtagaagcagagccaattaaaaaggcagataagctgttaaagctacagtta
gatctcggatttgagcgtagacaggtggtttcaggaattgctcaattttataaaccagaa
gagttagttggacaaagagtcatttgtgtgactaatttaaagccggtgaaattacgtggt
gaattatctcaaggaatgattcttgcaggtcaaaaggatggaatcatgtcgttagccaca
gtaagtgactctcttccgctaggagcgaaagtgaaataa

DBGET integrated database retrieval system