KEGG   Bacillus sp. Y1: DOE78_00750Help
Entry
DOE78_00750       CDS       T05922                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bacq  Bacillus sp. Y1
Pathway
bacq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bacq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DOE78_00750 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bacq03011]
    DOE78_00750 (rplV)
Ribosome [BR:bacq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DOE78_00750 (rplV)
  Bacteria
    DOE78_00750 (rplV)
  Archaea
    DOE78_00750 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 BAR_3_WASP_bdg TINF2_N
Motif
Other DBs
NCBI-ProteinID: AYA74115
UniProt: A0A385NIV5
Position
141558..141899
Genome map
AA seq 113 aa AA seqDB search
MQAKAVLRTVRIAPRKARLVVDLIRGKQVGEAVAILKHTPKTASPVIEKLLNSAIANAEH
NYEMDVNSLVVSQAFVDEGPTLKRFRPRAMGRASAINKRTSHITIVLTEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagctgtattaagaacagtacgtattgctcctcgtaaagctcgtttagtc
gtagatttaattcgaggtaagcaagtaggagaagcagtagcgattttaaagcatacacca
aaaactgcttcaccagttattgaaaaattattaaactctgcgattgctaatgcagaacat
aactatgaaatggacgttaacagcttagtagtatctcaagcattcgttgacgaaggacca
actttaaaacgtttccgtcctcgtgcaatgggtcgtgcaagtgctattaacaagcgtact
agccatattactatcgtattaacagagaagaaggagggataa

DBGET integrated database retrieval system