KEGG   Bacillus sp. Y1: DOE78_01175Help
Entry
DOE78_01175       CDS       T05922                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bacq  Bacillus sp. Y1
Pathway
bacq00010  Glycolysis / Gluconeogenesis
bacq00071  Fatty acid degradation
bacq00350  Tyrosine metabolism
bacq00620  Pyruvate metabolism
bacq00625  Chloroalkane and chloroalkene degradation
bacq00626  Naphthalene degradation
bacq00650  Butanoate metabolism
bacq01100  Metabolic pathways
bacq01110  Biosynthesis of secondary metabolites
bacq01120  Microbial metabolism in diverse environments
bacq01130  Biosynthesis of antibiotics
bacq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bacq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DOE78_01175
   00620 Pyruvate metabolism
    DOE78_01175
   00650 Butanoate metabolism
    DOE78_01175
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DOE78_01175
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DOE78_01175
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DOE78_01175
   00626 Naphthalene degradation
    DOE78_01175
Enzymes [BR:bacq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DOE78_01175
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     DOE78_01175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AYA74188
UniProt: A0A385NLP2
Position
complement(210276..212879)
Genome map
AA seq 867 aa AA seqDB search
MAVEEKVLTENQEVAKMIDELVAKGQKALKEFQGFTQEMIDDIVKEMALAGLDQHMPLAK
LAVEETGRGVFEDKMIKNIFATEYVYNNIKNNKTVGIIDDNQYEGVYTIADPVGVVAGVT
PVTNPTSTTMFKSLIAIKTRNPIIFAFHPSAQKCSSEAARVVRDAAIKAGAPENCIQWVE
KPSVAATQALMKHPGISLILATGGPGMVKSAYSSGKPALGVGAGNVPCYIEKSAKIKRAV
NDLILSKTFDNGMICASEQAVIIDKEIYNEVKKELISNKCYFLNDAEKKKVEALVINENT
CAVNPTIVGMPAAKIAQLAGVEVPEDTKILIAELKTVGPESPLSREKLSPVLACFKVNSL
EEGLTRAEEMLEFGGLGHSAVLHSTNEEVMKEFGLRMKAGRIIVNAPSSQGAIGDIYNAF
MPSLTLGCGTFGGNSVSQNVGAIHLVNIKKLAKRNNNMQWFKVPPKIYFEKNSTQYLAKM
PNISRAFIVTDPGMVKLGYVDVVTRYLRQRPDLVHVEVFSAVEPDPSIDTVMKGAEAMAA
FQPDVIIALGGGSAMDAAKGMWLFYEHPDADFFGLKQKFLDIRKRVVKYPKLGEKTQFVA
IPTTSGTGSEVTSFSVITDKLNNIKYPLADYELTPDVAIIDPQFVMTVPKVITADTGMDV
LTHAFEAYVSIMANDYTDGLAMKAIQLVFEYLPKAYRDGSDAVAREKMHNASTIAGMAFA
NAFLGINHSLAHKLGAEFHIAHGRSNTILMPHVIRYNATKPTKFAAFPKYENFIADQRYA
EIARTLGLPARTTEEGVESLIQAVIKLAKELEIPMSIEANGVTKEAFEAKVDYLAERAFE
DQCTTANPKLPLVTELAEIYREAFKGV
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgaagaaaaagtactaactgaaaatcaagaagtagcaaaaatgattgatgag
ttagttgcaaaaggtcaaaaagcgttgaaagaattccaaggtttcacacaagaaatgatt
gatgacattgtaaaagaaatggctcttgctggacttgaccaacatatgcctctagcgaaa
ttagcggtagaagaaacaggccgcggagtatttgaagataaaatgattaaaaacattttt
gcaacagagtatgtttacaacaatattaagaataacaaaacagttggaattatcgatgac
aaccaatatgaaggtgtttatacaatcgctgatccagttggagtggttgctggggtaaca
cctgtaaccaacccaacatcaactacaatgttcaagtcattaattgctatcaaaacaaga
aacccaatcatctttgctttccatccatctgcacaaaaatgtagcagtgaagcagcgcgt
gtcgtacgtgatgcagccattaaagctggtgctcctgaaaactgtatccagtgggttgaa
aagccatctgtagcagctactcaagcattaatgaagcaccctggaatttcacttatttta
gcaactggtggacctggaatggttaaatcagcttatagctctggtaagcctgctctaggt
gttggtgctggtaacgttccttgttatatcgaaaagtcagcaaaaattaagcgtgcagta
aacgacttaatattatctaaaacattcgataatggtatgatttgtgcatctgaacaagct
gttattatcgataaagaaatctacaatgaagtgaagaaagaactaatttctaataagtgc
tacttcctaaacgatgcagaaaagaaaaaggttgaggcattggttattaatgaaaatact
tgtgcagttaacccgactatcgtagggatgcctgctgctaaaattgcacagcttgctgga
gtagaagtgcctgaagatacaaagattcttattgctgaacttaagacagttggacctgaa
tctccactttctcgtgaaaaactaagccctgtacttgcttgctttaaggtaaacagctta
gaagaaggtttaacacgtgctgaagaaatgcttgaattcggtggacttggtcactcagct
gttcttcactcaacaaatgaagaagtaatgaaggaatttggacttcgtatgaaggcgggt
cgtatcatcgttaatgccccttcttcacaaggtgcaattggcgacatctataacgcattt
atgccatcattaacacttggttgcggtacattcggtggtaactctgtatctcaaaacgta
ggagctatccatcttgtaaatattaaaaagttagcgaagaggaataataatatgcaatgg
tttaaggttccacctaaaatctatttcgaaaagaattctactcaatatctagctaagatg
ccaaatatttcaagagcatttattgtaactgaccctggaatggtgaagcttgggtatgta
gatgtggttactcgttaccttcgtcaacgtcctgacttagttcatgttgaggtattctct
gcagttgagccagatccatcaatcgatacagttatgaagggtgctgaagcaatggcggca
ttccaaccagatgtgattattgcacttggtggaggatctgcaatggatgcagcgaaaggt
atgtggttattctacgaacacccagatgcagacttctttggattaaaacaaaaattctta
gatattcgtaagcgtgtggtgaaatatcctaagcttggtgaaaaaactcagttcgttgcg
attccaacaacatctggaacaggatctgaagtaacatctttctctgttatcacagataaa
ttaaacaacattaagtatccattagctgattacgaattaacaccagatgtagcaattatt
gatccacagtttgtcatgacggttcctaaagtaattactgctgatacaggtatggacgta
ttaactcatgcgttcgaagcttatgtatctattatggctaacgactatactgatggctta
gcaatgaaagctattcagcttgtattcgaatatctaccaaaagcataccgtgatggtagc
gatgcagtagcacgtgaaaaaatgcataatgcttcaacaattgcgggtatggcatttgct
aacgcattccttggaattaaccacagtttggcgcataagcttggtgcggaattccacatt
gctcacggacgctctaacaccatcttaatgccacatgttattcgttataatgcaacaaaa
ccaacaaagtttgctgcattccctaaatacgagaactttatcgctgaccagcgttatgct
gaaattgcaagaacattaggtcttcctgctcgtacaactgaagagggtgttgaaagctta
atccaagcggttatcaagcttgctaaagagctagaaatccctatgagtattgaagctaac
ggagtaacaaaagaagcatttgaagcaaaagttgattaccttgctgagcgtgcctttgaa
gatcaatgtacaacagctaaccctaaattaccgctagtaacagaattagcagaaatttac
cgtgaagcattcaaaggtgtataa

DBGET integrated database retrieval system