KEGG   Bacillus sp. SDLI1: AUL54_05875Help
Entry
AUL54_05875       CDS       T05207                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bacs  Bacillus sp. SDLI1
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bacs03009]
    AUL54_05875
Enzymes [BR:bacs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     AUL54_05875
Ribosome biogenesis [BR:bacs03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AUL54_05875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 DUF1347
Motif
Other DBs
NCBI-ProteinID: AME05916
UniProt: A0A0X8KF37
Position
1288922..1289830
Genome map
AA seq 302 aa AA seqDB search
MKQNDRGLELLITEKHAGQWLFSVLKSEFQASKPVITEWMNQESIQVNRTSPKNNIILKT
GDRLFIDLQEKTESSVIPEYGEAEILFEDNHMLIANKPAGMPTHPNEEGQTGTLSNLIAY
HFQINGEQAKVRHVHRLDRDTSGAVVFAKHRLAHAILDRQLETKTLKRTYIAAAEGKVTP
KKGTVDSPIGRDRSHSVRRRVSPGGQAAVTHYKVKGYHSGAQLSLVELELETGRTHQIRV
HMASIGHPLAGDDLYGGSRALFHRQALHAKKVSVVHPVSGEEIIAEAPMPADLAHFADTY
FS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaatgaccgcgggctggaacttctgataacggaaaagcacgccggacaatgg
ctgttttcagtcctgaaatcagaatttcaggcatcaaaacccgtgataaccgaatggatg
aaccaagaaagcattcaggtcaatcgcacatctcccaaaaacaacatcatcctgaaaacc
ggagaccgcctgttcattgatcttcaggaaaaaacggagtcatcggtgatcccggaatac
ggggaagcggaaatcttatttgaggacaatcatatgctgattgcaaataagccggcgggg
atgccgactcatccgaatgaagagggtcagaccggaaccctcagcaatctgatcgcttac
cattttcaaatcaacggcgaacaagcgaaagtccgccatgttcaccggcttgaccgggac
acgtcaggtgcggtcgttttcgctaaacaccgcctggctcatgccatcctcgatcggcag
cttgaaaccaaaacattaaaacgaacctatatcgccgcagcggaaggaaaagtgacgccg
aaaaaaggcacggttgattcgccgatcggccgcgacaggtcacattccgtcagacggcgc
gtctcacccggcggacaagccgccgtcacccattacaaggtaaaaggctatcattccggc
gcgcagctttctctggtcgagcttgaattggaaaccggaagaacacatcaaatcagagtg
catatggcaagcatcggccatccgttagcgggagatgacctgtacggcggaagccgggcg
ctgtttcacagacaggcgcttcacgccaaaaaggtcagcgtcgtccatccggtctccgga
gaagaaatcattgccgaagcgccgatgcccgctgatctggcacactttgccgacacgtat
ttttcttaa

DBGET integrated database retrieval system