KEGG   Bacillus sp. SDLI1: AUL54_08640Help
Entry
AUL54_08640       CDS       T05207                                 

Definition
(GenBank) sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AUL54_08640
Enzymes [BR:bacs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     AUL54_08640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2 ARD
Motif
Other DBs
NCBI-ProteinID: AME06408
UniProt: A0A0X8KG18
Position
complement(1817415..1817918)
Genome map
AA seq 167 aa AA seqDB search
MTISKQDVNAYYQKAGIVLTDDEVEDIQIMDYGLGKLEETGLQLFIYVNTDRYCSKELVL
FPRQTCPEHRHPPVGGEKGKQETFRCRWGKVYLYVEGEKAENPSVLPPEEDKEYYTVWNE
IVLEPGEQYTIPPDTKHWFQAGEEGAVVTEMSSPSTDDHDVFTDPRI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacgatatcgaagcaagacgtaaatgcatactatcaaaaagcgggaatcgttctgaca
gatgatgaagtcgaagatattcaaatcatggattacggcttaggcaagcttgaggaaacc
gggcttcagctgtttatttacgtgaataccgaccgctactgttcaaaagaattggtgctc
ttcccgcgccagacgtgtccggaacaccgtcatccgccggtcggcggcgaaaagggaaaa
caagagacattccgctgccgctgggggaaggtgtatctctacgtagaaggcgaaaaggca
gagaacccaagcgtcctcccgccggaagaagataaggaatactacactgtctggaatgaa
attgtgctggaaccgggcgaacaatacaccattccgccggatacgaaacattggttccaa
gcgggagaagaaggggcggtcgttacggaaatgtcatcgccaagcacggatgatcacgac
gtttttaccgacccgcgtatttaa

DBGET integrated database retrieval system