KEGG   Bacillus sp. SDLI1: AUL54_08725Help
Entry
AUL54_08725       CDS       T05207                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00051  Fructose and mannose metabolism
bacs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AUL54_08725
Enzymes [BR:bacs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AUL54_08725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AME06425
UniProt: A0A0X8KG45
Position
complement(1834695..1835816)
Genome map
AA seq 373 aa AA seqDB search
MIALHFGAGNIGRGFIGALLHHSGYEVVFADVNETMVGLLNDKKEYTVELADGGRQTEII
GPVSAINSAAQEQELFRLINDAAIITTAVGPNVLRLIAPSIAEGLKRRTSSEPLNIIACE
NMIGGSRFLKKEVFGHLTEAERELVDRTVGFPDSAVDRIVPIQHHEDPLKVSVEPFFEWV
IDRTGFAGGQPALKGAIFTDDLTPFIVRKLFTVNTGHAVTAYVGYQRGLKTVKEAIGHPE
IRRVVYDALSETGEYLVKAYGFKQAEHEQYMKKIISRFENEYITDDVTRVARSPLRKLGA
NDRLVGPAKKIKEPNALAEGIAAALRFDYHDDPEAVELQKLIAEKGTSGVLEDICGIQPH
EPLHGIVLKKLNQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgattgcccttcatttcggagcgggaaacatcgggcggggctttatcggcgctttgctc
catcattccggctatgaggttgtttttgcagacgtgaatgaaacgatggtcggccttctc
aatgataagaaggaatataccgtggagcttgccgacggcggccggcagacagaaatcatc
ggccccgtttcagccatcaacagcgcggcgcaagaacaagagctgttcaggctgatcaat
gacgcggcgatcattacgacggcggtgggcccgaacgttctgaggctcatcgccccgtcg
atcgcggaagggctgaagcgcagaacgtcctctgagcctctcaatatcattgcctgtgaa
aatatgatcggcggcagccgttttctgaaaaaagaagttttcggacatttgacggaagcg
gagcgggaactcgttgaccggacggtcggcttccctgattctgcggtggaccggatcgtg
ccgattcagcaccatgaagacccgctgaaagtatccgtagaaccgttttttgaatgggtc
atagacagaaccggctttgccggcggccagccggcacttaaaggtgcgatatttacggat
gatcttacgcctttcatcgtgagaaagctgtttaccgtcaataccggccatgccgttacg
gcgtacgtcggctatcagcgcggattaaaaaccgtcaaagaggccatcggccatccggaa
atccggcgtgtcgtgtacgatgcactttcagaaacgggcgagtacttggtgaaagcgtac
ggctttaagcaagccgaacacgagcagtacatgaagaaaatcatcagtcgttttgaaaat
gaatacatcacggatgatgtgacaagagtcgccagatcaccgctcagaaaactcggagcg
aatgatagattagtagggcccgcaaaaaaaataaaagaaccgaacgcgctggcagaaggc
atcgccgccgccctgcgctttgactatcatgatgatccggaagcggttgagctgcagaag
cttatcgcggaaaaaggaacgagcggtgttctggaagacatttgcggtattcagccgcat
gagccgctgcacggcatcgtgctcaaaaaactcaatcaataa

DBGET integrated database retrieval system