KEGG   Bacillus sp. SDLI1: AUL54_10510Help
Entry
AUL54_10510       CDS       T05207                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00450  Selenocompound metabolism
bacs00970  Aminoacyl-tRNA biosynthesis
bacs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AUL54_10510
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AUL54_10510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bacs01007]
    AUL54_10510
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bacs03016]
    AUL54_10510
Enzymes [BR:bacs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AUL54_10510
Amino acid related enzymes [BR:bacs01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AUL54_10510
Transfer RNA biogenesis [BR:bacs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AUL54_10510
 Prokaryotic type
   Other AARSs
    AUL54_10510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AME06734
UniProt: A0A0X8KGL6
Position
complement(2196725..2198716)
Genome map
AA seq 663 aa AA seqDB search
MPQDNNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQ
QKAEEENITPQAYVDRAVAEIQKLWKQLDISHDDFIRTTESRHKEIIEKVFQKLLDNGDI
YLDEYEGWYSIPDETFYTETQLVDVERNEKGEVVGGKSPDSGHPVELIKEESYFFRMSKY
ADRLLKFYEDNPSFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPGNPKHVVYVW
IDALFNYITALGYDTENDELYKKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVF
AHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERIN
YDLANDLGNLLNRTVAMIQKYFDGEIGSYEGNVTDFDSELSSVAGETVKAYEKAMENMEF
SVALSTLWQLISRTNKYIDETAPWVLAKDPEKEKELRSVMYHLAESLRISAVLLQPFLTQ
TPEKMFAQLGIEDQSLKAWDSIQTFGQLKNAKVKKGEPLFPRLEAEEEVAYIKQKMQGTA
PVKEEKTEEPQEAERLPEITFDQFMDTELRVAEVLSAEPVKKADRLLKLQIDLGFEQRQV
VSGIAKHYTPDQLVGMKIICVTNLKPVKLRGELSQGMILAGESDGVLKVVAVDQSLPKGT
RIK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagacaataatactttttatattacgaccccgatatattatccgagcggaaaa
ttacatatcggccatgcttatactaccgtggccggcgatgcgatggcgcgttacaaaaga
ttaaagggatttgacgtacgctacctgacaggaacggatgaacacggacaaaaaatccag
cagaaagcggaggaagagaatatcacacctcaggcttacgtggatcgtgctgtggctgag
atccaaaaactatggaagcagctcgacatttctcacgatgatttcatccggacgacggaa
agccggcataaagaaattattgagaaagtgttccaaaagcttcttgataatggtgatatc
tatcttgatgagtatgagggctggtacagcatccctgatgaaacattctatactgaaaca
cagctggtggatgtggaacgaaatgaaaagggtgaggttgtcggcggaaaaagcccggac
agcggccacccagtcgaattaatcaaagaggagtcatacttcttccgcatgagcaaatat
gcagaccgcctgctgaagttttatgaggacaatccttccttcatccagcctgaatcacgc
aaaaatgaaatgattaacaatttcattaaaccggggcttgaagatttggccgtttccaga
acgacgtttgactggggtgtaaaagtgccgggaaacccgaagcatgtcgtgtatgtatgg
attgacgcattgttcaactacattacggcgctcggttacgatacggaaaatgatgagctt
tacaaaaagtactggcctgctgacgtccaccttgtcggtaaagaaattgtccgttttcat
accatttactggccgattatgctgatggcgcttgatctcccgcttcctaagcaagtattc
gcgcatggctggttattgatgaaagacggaaaaatgtcgaaatcaaaaggaaatgtcgtt
gatccggtaacattgattgaacgctacggcttggatgagcttcgctattacctgcttcgc
gaagtgccatttggttcagacggtgtctttacgccggaaggttttgtagaacggattaat
tatgacttggcaaacgacttaggaaaccttctgaatcgtacagttgctatgatccaaaaa
tattttgacggtgagatcggttcatatgaaggaaatgtgaccgattttgattcagagctt
tcttctgtagccggtgaaacggttaaagcatatgaaaaggcaatggaaaacatggagttc
tcagtggctttatcaacgctatggcaattaatcagccgtacgaacaaatatattgatgaa
actgctccgtgggtgctggccaaagatccggaaaaagaaaaagaattacgttctgtcatg
tatcatttagctgaatcattgcgtatttcggccgtactgcttcagcctttcttaacgcag
acgcctgaaaaaatgtttgctcagctcggaattgaggatcagtctcttaaagcttgggac
agcattcagacattcggccaattaaagaacgcgaaagtgaaaaaaggggagccgcttttc
cctcgtcttgaagctgaagaggaagtagcttacatcaagcaaaaaatgcaagggactgct
cctgtgaaagaagaaaaaacagaagagccgcaagaagcagagcgtcttccggaaattacg
tttgatcaatttatggatacagaacttcgcgtcgcagaagtcttgtccgcagaaccggtg
aaaaaagcggaccgtctgctgaagctgcaaattgatctgggctttgaacagcgccaagtt
gtatcaggtattgcgaagcattacacaccggatcagcttgtgggaatgaagatcatttgt
gtaacgaatctaaaaccggtaaaattgagaggcgagctttcccaagggatgatactggca
ggagaatctgacggcgtccttaaggttgtagctgtcgaccagtcattaccgaaaggcact
agaattaaataa

DBGET integrated database retrieval system