KEGG   Bacillus sp. SDLI1: AUL54_11195Help
Entry
AUL54_11195       CDS       T05207                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00220  Arginine biosynthesis
bacs00330  Arginine and proline metabolism
bacs01100  Metabolic pathways
bacs01110  Biosynthesis of secondary metabolites
bacs01130  Biosynthesis of antibiotics
bacs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AUL54_11195
   00330 Arginine and proline metabolism
    AUL54_11195
Enzymes [BR:bacs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AUL54_11195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AME06847
UniProt: A0A109WFB7
Position
2324563..2325453
Genome map
AA seq 296 aa AA seqDB search
MNKNISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYAVEDLGDIPVNREKLKND
EELKNLNSVLSGNEQLAHKVDSVIENERFPLVLGGDHSIAIGTLTGTAKHYKQLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGVGHDTLVNLGGYAPKIKPENVVIIGARSLDEGER
EYIKETGMKVYTMHEIDRLGMTKVIEETIDYLSDCDGVHLSLDLDGLDPSDAPGVGTPVV
GGISYRESHLAMEMLHDADIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaatatctcagttattggaatgccgatggatttaggacaagcacgacgcgga
gtggacatgggcccgagcgccatccgctacgcgcatctcattgaacggttatctgacatg
gggtatgcggtggaagacttaggcgacatccccgtcaatcgtgaaaaactcaaaaatgat
gaagagctgaaaaatctgaactctgtgctttcagggaacgagcagctcgcccataaggtg
gacagcgtcatcgagaatgagcggttccctctcgtcttaggcggcgatcacagcatcgcg
atcggaacgctgacaggaacggccaagcattataaacagctcggcgtcatctggtacgat
gcgcacggcgatctaaatacgctggaaacatcgccgtcaggcaatattcacggaatgccg
ctggccgtcagcctcggcgtcgggcacgacacattggtgaatctgggcggctatgctccg
aaaatcaagccggaaaacgtcgtcatcatcggcgcgagatcgcttgacgaaggcgagcgt
gaatacattaaggaaacaggcatgaaggtttatacgatgcatgagattgaccgcctcggc
atgacgaaggtcattgaagaaaccattgactacctgtcagactgtgacggcgttcacctc
agccttgatctcgacggcctcgatccgagcgacgcgcccggcgtagggacgcctgtcgtc
ggcggcatcagctaccgtgaaagccatttggcaatggaaatgctgcatgatgccgacatt
atcacctcagctgaatttgtcgaagtcaacccgatcctcgatcacaaaaacaaaaccggc
aaaacagcggttgagctggtggaatctttgttgggaaaaaaactattataa

DBGET integrated database retrieval system