KEGG   Bacillus sp. SDLI1: AUL54_16480Help
Entry
AUL54_16480       CDS       T05207                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00010  Glycolysis / Gluconeogenesis
bacs00053  Ascorbate and aldarate metabolism
bacs00071  Fatty acid degradation
bacs00280  Valine, leucine and isoleucine degradation
bacs00310  Lysine degradation
bacs00330  Arginine and proline metabolism
bacs00340  Histidine metabolism
bacs00380  Tryptophan metabolism
bacs00410  beta-Alanine metabolism
bacs00561  Glycerolipid metabolism
bacs00620  Pyruvate metabolism
bacs00625  Chloroalkane and chloroalkene degradation
bacs01100  Metabolic pathways
bacs01110  Biosynthesis of secondary metabolites
bacs01120  Microbial metabolism in diverse environments
bacs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AUL54_16480
   00053 Ascorbate and aldarate metabolism
    AUL54_16480
   00620 Pyruvate metabolism
    AUL54_16480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AUL54_16480
   00561 Glycerolipid metabolism
    AUL54_16480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AUL54_16480
   00310 Lysine degradation
    AUL54_16480
   00330 Arginine and proline metabolism
    AUL54_16480
   00340 Histidine metabolism
    AUL54_16480
   00380 Tryptophan metabolism
    AUL54_16480
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AUL54_16480
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AUL54_16480
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AUL54_16480
Enzymes [BR:bacs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AUL54_16480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh NUMOD3
Motif
Other DBs
NCBI-ProteinID: AME07798
UniProt: A0A0X8KIP1
Position
complement(3356783..3358153)
Genome map
AA seq 456 aa AA seqDB search
MNSIPSIVSNHKTYFAAGHTRPLESRLNILQKLKQAVKTHEADLIAALYQDLHKSEQEAY
STEIGIILEEISFVMKRLGKWIKPKRVKTPLTHLGSKSIIIPEPYGTVLVIAPWNYPLQL
ALSPLIGAIAAGNTVILKPSEYTPAVSAVLSKLISSVFPTDYVAMAEGGPDVSTVLLQQP
FDYIFFTGSVAVGKIVMEAAAKQLIPVTLELGGKSPCIVHKDADIQLAAKRIVFGKFTNA
GQTCIAPDYLFVHQDIKTKLTEEIKRAISEFYGPQPEQNPQYGKIVSERHYQRLLSFLND
GVPLTGGQFNPDHHKIAPTILDQVKDDSPVMQEEIFGPILPLFTYSDIDEVIEKVQSRPK
PLALYVFTTNKGIERTVLENLSFGGGCVNDTLMHVATPYLPFGGVGESGIGSYHGFDSFN
AFTHKKSVVKQTNRFDFAFRYPSSKNGLRMIRKILK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcatcccctctatcgtcagcaatcacaaaacctattttgcagcgggacatacg
agaccgcttgaatcgagactgaacattttgcagaagctgaaacaagccgtcaaaactcat
gaagccgatctcatagccgctctctaccaggatctccacaaatctgagcaagaagcgtac
tcaacagaaatcggaatcatcttggaggaaatcagctttgtgatgaagcggctgggaaaa
tggatcaaaccgaaacgagtcaaaacaccactgactcacctaggctcgaaaagcatcatc
atccctgagccatatggaaccgttttggtgattgcgccttggaattatcccttgcagctg
gcgctttcacccttgattggagccattgcggccggaaacacagtcattcttaaaccgtca
gaatatacgccggcggtttccgctgttctttccaaactcatcagcagcgtttttccgacc
gattatgtcgctatggcggagggcgggcccgacgtcagcacggtgttattacagcagccc
tttgactatattttcttcacaggaagcgttgccgtgggaaaaatcgtcatggaggccgcc
gccaaacaattaattcccgttaccttggagctcggcggcaaaagtccctgcattgtccat
aaggatgctgatatacagcttgccgccaaacgcatcgtcttcgggaaatttacaaatgca
gggcaaacctgcatcgcaccggattatttatttgtccaccaagatatcaaaacgaagctc
acagaagaaataaagcgtgcgatcagtgaattttacggccctcagcctgaacaaaatccg
cagtacggcaaaatcgtcagtgaacgccactatcagcggctgctcagctttctgaatgat
ggcgtcccgcttacaggcggacaatttaatcctgatcaccataaaatagcgccgacgatt
ctagatcaagtgaaggatgactctccagtgatgcaggaggagattttcgggccgattctt
ccgctgtttacatacagcgatatcgatgaagtcatcgagaaagtccaatcacgcccaaag
ccgctcgctctttatgtcttcacaacaaacaaaggaatcgagcgaactgttttagagaat
ctgtcatttggcggcggctgtgtcaatgatacgttaatgcacgtcgcgacaccgtatttg
ccattcggcggcgtcggagaaagcggcatcggcagctatcacggatttgacagctttaac
gcatttacgcacaaaaaaagcgtcgtcaaacaaacgaaccgcttcgacttcgctttccgt
tatccttcttccaaaaacgggctgcgaatgattcggaaaatacttaaataa

DBGET integrated database retrieval system