KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998097Help
Entry
102998097         CDS       T03086                                 

Gene name
IGFBP3
Definition
(RefSeq) insulin like growth factor binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04115  p53 signaling pathway
bacu04218  Cellular senescence
bacu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102998097 (IGFBP3)
   04218 Cellular senescence
    102998097 (IGFBP3)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    102998097 (IGFBP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    102998097 (IGFBP3)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102998097 (IGFBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1
Motif
Other DBs
NCBI-GeneID: 102998097
NCBI-ProteinID: XP_007187746
UniProt: A0A384AK46
Position
Un
AA seq 146 aa AA seqDB search
MGSTENQALSGTHRVPDSKFHPVHTKMDVIKKGHAKDSQRYKVDYESQSTDTQNFSSESK
RETEYGPCRREMEDTLNHLKFLNMLSPRGIHIPNCDKKGFYKKKQCRPSKGRKRGFCWCV
DKYGQPLPGFDVKGKGDVHCYSMESK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggggagcacagagaaccaggccctgagcggcacgcacagggtgcccgactccaaattc
caccccgtccacaccaagatggacgtcatcaagaaaggacacgccaaggacagccagcgc
tacaaggtcgactatgagtctcagagcacagacacccagaacttctcctccgagtccaag
cgtgagacggaatacgggccctgccgccgggagatggaggacacgctgaaccatctcaag
ttcctgaacatgctcagccccaggggtatccacattcccaactgcgacaagaagggcttc
tacaagaaaaagcagtgccgcccttccaaaggcaggaagcggggcttctgctggtgcgtg
gataagtacgggcagcccctcccgggcttcgacgtgaaggggaaaggggacgtgcactgc
tacagcatggagagcaagtaa

DBGET integrated database retrieval system