KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999275Help
Entry
102999275         CDS       T03086                                 

Gene name
PLA2G4B
Definition
(RefSeq) phospholipase A2 group IVB
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00564  Glycerophospholipid metabolism
bacu00565  Ether lipid metabolism
bacu00590  Arachidonic acid metabolism
bacu00591  Linoleic acid metabolism
bacu00592  alpha-Linolenic acid metabolism
bacu01100  Metabolic pathways
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04217  Necroptosis
bacu04270  Vascular smooth muscle contraction
bacu04370  VEGF signaling pathway
bacu04611  Platelet activation
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04724  Glutamatergic synapse
bacu04726  Serotonergic synapse
bacu04730  Long-term depression
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04921  Oxytocin signaling pathway
bacu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102999275 (PLA2G4B)
   00565 Ether lipid metabolism
    102999275 (PLA2G4B)
   00590 Arachidonic acid metabolism
    102999275 (PLA2G4B)
   00591 Linoleic acid metabolism
    102999275 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    102999275 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102999275 (PLA2G4B)
   04010 MAPK signaling pathway
    102999275 (PLA2G4B)
   04370 VEGF signaling pathway
    102999275 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    102999275 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102999275 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102999275 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    102999275 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    102999275 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102999275 (PLA2G4B)
   04913 Ovarian steroidogenesis
    102999275 (PLA2G4B)
   04921 Oxytocin signaling pathway
    102999275 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102999275 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    102999275 (PLA2G4B)
   04726 Serotonergic synapse
    102999275 (PLA2G4B)
   04730 Long-term depression
    102999275 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102999275 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102999275 (PLA2G4B)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102999275 (PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 102999275
NCBI-ProteinID: XP_007180408
UniProt: A0A383ZZP3
Position
Un
AA seq 781 aa AA seqDB search
MALAKVPGTCLLTIHVLQAHGLPSKDLVTPSDCYVTLWLPSASSQQLQTRTVKNSRNPVW
NQSFHFRIHSQLKNIVQLKVFDQDLLTKDDPLLSVLFDVGTLRAGESRRESFSLNPQGKE
QLEVEFRLQNLTDCAERLVSNGILVARELSCLHVQLEKARGQQGSEGRVQLVVPGSYEGP
QEASVGAGSFRFHWPACWEQELSIHLQDAPQEQLKVPLRALPSDQVVRLVFPTSQEPLMK
VELKKEEGPRELAVRLDCGPCAEERAFLSRRKQVVAKALKQALQLDGDLQEDEIPVVAVM
ATGGGIRAMTSLYGQLAGLKELGLLDCISCITGASGSTWALANLYEDPEWSQKDLAGPIE
SLKMQVTKSKLGVLAPSQLWRYQQELAERARLGHPPCFTNLWALINEALLHDEPHDHKLS
DQREALSRGQNPLPIYCALNTKERNLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGRLTKRLPESRICFLEGIWSNLYAANLQDSLYWSSEPSQFWDRWAQAQASLDKEQVPL
LNIGEPPTAASRIAEFFTDLLTRRPLAQATHNFLRGLSFHKDYFQHPHFSAWKATKLDGL
PNQLTPAEPFLCLLDVGYLVNTSCPPLLRPTRDVDLILSLDYNLHGAFQQLQLLDRFCQK
QGIPFPSISPSPEEQRQPRECHLFSDPARPDAPAVLHFPLVNASFREHSAPGVRRTAEAQ
EAGEVNLSSSDSPYHYLKVTYSQEDMDKLLRLTHYNICNNQEQLLEALREAVRRRKQRRA
E
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcaaaggtgcctgggacctgcttgctcaccattcatgtcctgcaggcccat
ggcctgccctccaaggacctagtgactccctctgactgctacgtgactctgtggctgccc
tcggcctccagccagcagctccagacgcgcacggtcaagaacagcagaaaccccgtctgg
aatcagagctttcacttccgaatccacagccagctcaagaacatcgtgcaactcaaagtc
tttgaccaggaccttctgaccaaggatgaccctctgttgtcagtgctgtttgacgtgggg
actttgcgggctggggagtcccggcgtgagagcttctcgctgaaccctcagggcaaggag
cagctggaagttgaatttcggctgcagaatctgaccgactgtgctgagcgcctcgtcagt
aatggcatcctggtggcccgggagctctcctgcttgcatgttcaactggagaaggccagg
ggccagcaagggtcagagggcagagttcagcttgtggttcccgggtcctatgagggtccg
caggaggcctccgtgggcgccggctccttccgcttccattggccggcctgctgggagcag
gagctgagtattcacctgcaggatgcaccccaagagcagctgaaggtgcctctgagggca
ctgccctctgaccaagtggtgagacttgtcttccctacatcccaggagcccctgatgaag
gtggagctgaaaaaagaagaaggaccaagggagctggcagtgcggctggactgcgggccc
tgtgccgaggagcgggccttcctgagcaggaggaagcaggtggtggccaaggccctgaag
caggccctgcagctggatggagacctgcaggaggatgagattccagtggtagctgttatg
gccactggtggtgggatccgggccatgacttccctgtacgggcagctggctggcctgaag
gagctgggcctcttggattgcatctcctgcatcacaggggcctcgggctccacctgggct
ttggccaacctctacgaggacccagagtggtctcagaaggacctggcagggcccatcgag
tcactgaagatgcaggtgaccaagagcaagctgggcgtgctggcccccagccagctgtgg
cggtaccagcaggagctggctgagcgtgcgcgcctgggccacccgccctgcttcaccaac
ctgtgggccctcatcaacgaggcgctgttgcatgacgagcctcacgaccacaaactctca
gaccagcgggaggccctgagccgtggccagaaccctctgcccatctactgtgctctcaac
accaaagaacggaacctgactacctttgaatttggggagtggtgtgagttctccccctat
gaggtcggctttcccaagtacggcgccttcatcccctctgagctctttggctccgagttc
ttcatggggcgcctgacaaagcggcttcctgagtcccgcatctgcttcctggaaggcatc
tggagcaacctgtacgcagccaacctacaggacagcttgtattggtcctccgagcccagc
cagttctgggaccgctgggcacaggctcaggccagcctggacaaggagcaggtccccctt
ctgaatataggagagcctcccacagcggccagcaggatagctgagttcttcactgacctt
ctgacacggcgtccacttgcccaggccacccacaatttcctccgtggcctctctttccac
aaggactatttccagcatcctcacttctctgcctggaaagccaccaaactggatggcctc
cccaaccagctgacacctgcagagcccttcctttgcctgttggatgtgggctaccttgtc
aacaccagctgcccacccctcctgcggcccacacgggacgtggacctcatcctgtcgctg
gattacaacctccatggagcctttcagcagctgcagctcctggatcggttctgccagaag
cagggcatcccgttcccgtccatctcacccagccccgaggagcagcgccagccccgagag
tgccacctcttctcagaccctgcccgccctgacgcccctgccgtgctgcacttcccgctg
gtaaacgcctccttccgggagcactcagccccaggggtccggcggacggccgaggcgcag
gaggccggggaggtgaacctgtcttcatccgactccccctaccactacttgaaggtgacc
tacagccaggaggacatggacaagctgctccgcctgacgcactacaacatctgcaacaac
caggagcagctgctggaggccctgcgtgaggccgtgcggcggcgcaagcagcgccgggcc
gagtga

DBGET integrated database retrieval system