KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999726Help
Entry
102999726         CDS       T03086                                 

Gene name
IPO4
Definition
(RefSeq) importin 4
  KO
K20221  importin-4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bacu03009]
    102999726 (IPO4)
Ribosome biogenesis [BR:bacu03009]
 Eukaryotic Type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    102999726 (IPO4)
  Pre-60S particles
    102999726 (IPO4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT_2 HEAT_EZ HEAT RIX1 IFRD Cnd1 DUF3385 Adaptin_N
Motif
Other DBs
NCBI-GeneID: 102999726
NCBI-ProteinID: XP_007180678
UniProt: A0A384A0G6
Position
Un
AA seq 1054 aa AA seqDB search
MSEVTLTTLHTHCAASVPLRRCLLCPNLAEALFAHLEVSLLATPWRQGHRIQGRVLEGDW
GWGISPVYRHSVSLSLAQLSATVFRKEGLEAWPQLMQLLQHSIHSLHVPEREMGLLLLSV
VVTSRPEAFRPHHRELLRLLNETLGDVGSPGLLFYSLRTLTTMAPYLGTDDVPLVRMLVP
KLIVAVQILIPVDEAKACEALEALDELLESELPIITSHLSEVLTFCLEVARNVALGDAIR
VRILCCLTFLVKVKSKALLKNRLLPPLLHTLFPIMAAEPPLGQLDPEDQDSEEEELDVGL
VGETPKHFAVQVVDMLALHLPPEKLCPLLMPMLEEALRSQSPYQRKAGLLVLAVLSDGAG
DHIRQRLLSPLLQIVCRSLEDPSQVVRNAALFALGQFSENLQPHIRSYSGEVMPLLLAYL
KSVPPGCTRHLAKACYALENFVENLGPEVQHYLTELMECMLQPLRNPSSSRAKELAVSAL
GAIATAAQASMLPYFPTIVEHLREFLLTGHEDLQPVRIQSLETLGVLARAVGEPMRPLAE
ECCQLGLGLCDQVDDPDLRRCTYSLFAALSGLMGESLTPHLPRITTLMLLSLRSTEGIMP
QYNGSSTFLLFDDERGGEEEEELAEEDEEEEDDSEISGYSVENAFFDEKEDACAALGEIS
VNASVAFLPYMETVFEEVFTLLECPHLNVRKAAHEALGQFCCALHKACQSCPSEPNTAAL
QAALARVVPSYVRAVTGERERQVVMAVLSALTAVLRGSGSVALQPPGRLAELCHALKAVL
QRKTACQDTDQEEDEDQAEYDAMLLEHAGEAIPALAAAAGGDAFAPFFAGFLPLLLCKTK
QGCTVAEKSFAVGTLAESIQGLGAASAQFVSRLLPVLLSTAREADPEVRSNAVFGLGVLA
EHGGRPAQEHFPKLLGLLLPLLARERHDRVHDNICGALARLLMASPTRKPEPQVLAALLH
ALPLKEDLEEWVTLGHLFSFLYQSSPDQVVDVAPELLRICSLILAENKVPPDTKASLLLL
LTFLARQHADSFHSALGSLPGNKAQELQAILGLT
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggtcaccctcaccacactgcacacccactgtgctgctagtgttcctctgaga
cgttgtcttctgtgtcccaacttggcagaggccctgttcgcacacctggaggtttctctc
ctggccaccccatggaggcagggccatcgcatacagggaagggtactggagggtgattgg
gggtggggaatctctcctgtttataggcattctgtgagtcttagcctggcccagctctca
gctaccgtttttcgaaaagaaggcctggaggcctggcctcagctcatgcagcttcttcag
cacagtatccacagcctccacgtccctgagagagagatggggcttttgctgctaagtgtg
gtggtgacctcccggcctgaggccttccgaccccaccaccgggagcttcttcggcttctg
aatgagacccttggtgatgtgggctctcctgggctcctcttctattccctgcgcactctg
accaccatggccccttaccttggcactgatgatgtgcctctcgtgcggatgttggtgccc
aagctcattgtggccgtgcagattctgatccctgtagacgaggcaaaggcctgtgaggcc
ttggaggccctggatgaattgctggagtcagagttgcccatcatcacctcccacctttca
gaggtcctcacattctgcctggaggtggctagaaacgtggccctgggtgatgcaatacgt
gtgcgtattctttgctgcctcactttcttggtcaaagtcaagagcaaggccttactgaag
aatcgcctcctgccacccttgctgcacacccttttccccatcatggctgccgagcccccc
ctgggtcagctggatcctgaggaccaggattcagaggaggaagagctggatgttgggctg
gtgggggagacgcccaagcactttgccgttcaggtcgtggacatgctggcactccatttg
ccccctgagaagctctgtcctctgctgatgcccatgctggaagaggctttgcggagccag
agcccataccagcgcaaggctggcctcctggtgctggcggtgctctcggatggagccggg
gaccacatcaggcagagactgctgtccccactgctgcagatcgtgtgcaggagcctggag
gatccgtcacaggttgtgcgcaatgctgcgctctttgccctgggccagttctcagagaac
ctacagccccacattcgcagctattccggggaggtgatgccactgctcctcgcctaccta
aagtccgtgcctcctgggtgcacacgtcacctagccaaggcctgctatgctctggagaac
ttcgtggagaacctagggcctgaagtgcagcactaccttacggagctcatggagtgtatg
ttgcagcctctgaggaaccccagcagctcccgggccaaggagctggctgtgagcgccctg
ggggccattgccacggctgcccaggcctccatgctgccctacttccccaccatcgtggag
cacctgcgggaattcctgttgacaggccatgaggaccttcagcctgtgcggatccagagc
ctggagacacttggggtgctggcgcgagcagtaggggagcccatgaggcccctggctgag
gaatgctgccagctggggctgggcctgtgtgaccaggtagacgaccctgacttgcggcgc
tgcacgtacagcctgtttgcagccttatcggggctgatgggtgagagcctcactccccac
ctgccacgaatcaccacactcatgctgttgtcactgcgttccaccgagggcattatgcct
cagtacaatggaagcagcaccttccttctgtttgacgacgagcgcggtggggaggaagag
gaggagctcgcggaggaggacgaggaagaggaggatgactcagagatctcagggtacagc
gtggaaaacgccttcttcgatgagaaggaagacgcctgtgctgcgctgggggagatctct
gtgaatgccagtgtggccttccttccctacatggagactgtctttgaagaagtgttcaca
ctgctggagtgccctcacctgaacgtgcggaaggcagcccatgaggccctgggtcagttt
tgctgtgcgctgcacaaagcctgtcaaagctgcccctcggaacccaacactgctgctctg
caggccgcgctggcccgggtggtgccatcctacgtgcgggcagtgaccggggagcgggag
cgccaggtggtgatggccgtgctgtcagccctgacggcagtgttgcgcggctctgggagc
gtggcgttgcagccccccgggcggcttgctgagctctgccacgccctcaaggctgtgctg
cagaggaagacagcttgtcaggacaccgaccaggaggaggatgaggaccaggctgaatac
gacgccatgttgctggagcatgctggtgaggccatccctgccctggccgctgcggccggg
ggagatgcctttgcccccttctttgccggcttcctgccattattgctctgcaagacgaaa
cagggctgcacagtggcagagaagtcctttgcggtggggacgctggcggagtccattcag
ggcctgggtgccgcctcggcccagtttgtgtcccggctgctccccgtgctgttgagcacc
gcccgggaggcggaccccgaggtgcggagcaatgccgtctttgggctgggcgtgctggca
gagcacgggggtcgccctgcccaggaacacttccccaagctgctggggctcctgctgccc
ctcctggcgagggagcgccatgatcgtgtccatgacaacatctgtggggcacttgcccgc
ctgctgatggccagtcccacgaggaaaccagagccccaggtgctggctgccctgctgcac
gccctgccactgaaggaggatttggaggagtgggtcaccttagggcacctcttcagcttc
ctgtaccagagcagccctgaccaggttgtagatgtggctccagagctcctgcgcatttgc
agcctcatcctggccgagaacaaggtcccaccagacaccaaggcgtcgctgctgctgctc
ctcacgttcttggccagacagcacgctgacagcttccattcagcactgggctccctgcct
ggcaacaaggcccaggagctccaggccatcctgggcctcacctag

DBGET integrated database retrieval system