KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000274Help
Entry
103000274         CDS       T03086                                 

Gene name
GPX6
Definition
(RefSeq) glutathione peroxidase 6
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00480  Glutathione metabolism
bacu00590  Arachidonic acid metabolism
bacu01100  Metabolic pathways
bacu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103000274 (GPX6)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103000274 (GPX6)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    103000274 (GPX6)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103000274 (GPX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 103000274
NCBI-ProteinID: XP_007179167
UniProt: A0A383ZVL7
Position
Un
AA seq 264 aa AA seqDB search
MKAKITVMQPQTKESQKHKKLDEGLKRSRDPWGPEARLELLVQAIPQFWACCLFSLFLVG
FAQPTPKQQQMKVDCYKGVTGTIYEYGALALNGEEYIQFKQYAGKHVLFVNVATYXGLAG
QYPELNALQEELKPFGVVVLGFPCNQFGKQEPAKNSEILLGLKYVRPGGDFVPNFQLFEK
GDVNGEKEQKVFSFLKNSCPPTSDFLGSSSQLFWEPMKVHDIRWNFEKFLVGPDGVPIMR
WFHRASISTVKSDILEYMKQFKSK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaagattacggtgatgcagccacaaaccaaggagagccagaagcacaagaaa
ctggatgaggggctcaaaaggagccgagatccctggggacctgaggctcgcctagaactc
ctagtccaagccatcccgcagttctgggcctgctgtcttttctcactgttcctggtcggc
ttcgctcagccgaccccgaaacagcaacagatgaaggtggattgctataagggggtgaca
ggcaccatctatgagtatggagctctcgccctcaatggcgaggagtatatccagttcaaa
cagtatgcgggcaagcatgtcctctttgtcaatgtggccacctattgaggcttggcaggt
cagtatcctgaactgaatgcactacaggaggagctgaagccttttggtgtggttgtgttg
ggctttccctgcaaccaatttggaaaacaagaaccagcaaaaaactcagagatccttttg
gggcttaagtatgtacgtccaggtggtgactttgttcccaattttcagctctttgagaaa
ggggacgtgaatggagaaaaagaacagaaggtctttagcttcctgaagaactcctgccct
ccaacctctgattttttgggctcatcaagccaactcttctgggagcccatgaaggtccat
gacatccgctggaactttgagaagttcctggtggggcctgatggagtccctatcatgcgc
tggttccaccgggcttccatcagcacagtcaagtcagacatcctggagtacatgaagcag
ttcaaaagcaaatag

DBGET integrated database retrieval system