KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001603Help
Entry
103001603         CDS       T03086                                 

Gene name
CREM
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103001603 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103001603 (CREM)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103001603 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf TMCO5 Rh5
Motif
Other DBs
NCBI-GeneID: 103001603
NCBI-ProteinID: XP_007167414
UniProt: A0A383YXL2
Position
Un
AA seq 360 aa AA seqDB search
MSKCGRKKYIKTNLRQMTMETIDSQQDGSIPDSVAESESAHMQTQTGQNSIPTLAQVSVA
GSGTGRGSPAVTLVQLPSGQTVHVQGVFQTPQPSVIQSPQIQAIQVATIAETDESAESER
VIDFHKRREILSRRPSYRKILNELSSDVPGVPKIEEEKSEEEGTSPNIAAMALPTSIYQT
STGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFV
PGSQVVVQDEETELAPSHMAATTGDMPTYQIRAPTTALPQGVMMAASPGSLHSPQQLAEE
ATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCRKVE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatgtggcaggaaaaaatatattaaaacaaatctaagacaaatgaccatggaa
acaattgactctcagcaggatggaagtataccagattctgtggcagagagcgaatctgct
cacatgcagacgcagactggtcaaaattcaatccccactttagctcaggtttctgtagct
gggtcaggcaccggaagaggctccccagctgtaactctagtacagttaccttcaggccaa
actgtacatgtccagggagtatttcagacaccacagccgtcggttattcagtcaccacaa
atacaagctattcaggtagcaacaattgcagagacagatgagtctgcagaatcagaaaga
gtaattgattttcataaacgcagagaaatcctttcacgaagaccctcttaccgaaaaata
ctgaatgaactttcctctgatgtgcctggtgttcccaagattgaagaagaaaaatccgag
gaagaaggaacgtcaccgaatatcgctgccatggcattgccgactagcatatatcagact
agcacggggcaatacattgctatagcccaaggtggaacaatccagatttctaacccagga
tctgatggtgttcagggactgcaggcattaacaatgacaaattcaggagctcctccgcca
ggtgctacaattgtacagtacgcagcacagtcagcagatggcacacagcagttctttgtc
ccaggcagccaggtggtggttcaagatgaggaaactgaacttgccccaagtcacatggct
gccaccactggtgacatgccgacttaccagatccgagctccgaccactgctttgccgcag
ggagtaatgatggctgcctcgccgggaagcctgcacagtccccagcaactagcagaggaa
gcaacacgcaaacgagagctgaggctaatgaaaaatagggaagctgcccgggagtgtcgc
aggaagaagaaagaatatgtcaaatgtcttgaaaaccgtgtggctgtgcttgaaaaccag
aacaagactctcattgaggaactcaaggccctcaaagatctttactgccgtaaagtagag
tga

DBGET integrated database retrieval system