KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002248Help
Entry
103002248         CDS       T03086                                 

Gene name
TNFRSF13C
Definition
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04064  NF-kappa B signaling pathway
bacu04672  Intestinal immune network for IgA production
bacu05166  Human T-cell leukemia virus 1 infection
bacu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103002248 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103002248 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    103002248 (TNFRSF13C)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    103002248 (TNFRSF13C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103002248 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bacu04050]
    103002248 (TNFRSF13C)
   04090 CD molecules [BR:bacu04090]
    103002248 (TNFRSF13C)
Cytokine receptors [BR:bacu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103002248 (TNFRSF13C)
CD molecules [BR:bacu04090]
 Proteins
  103002248 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind TACI-CRD2
Motif
Other DBs
NCBI-GeneID: 103002248
NCBI-ProteinID: XP_007189364
Position
Un
AA seq 158 aa AA seqDB search
MRRGARGLRGRDRPATPQCLQTQCFDPLVRKCVACSLLRTTEPRPAGGPSSLAPGTALQP
QEALVLLGLVSGRRRRRRPGTAAAPEALEAPDGDQDAPEPLDSDSILSPGTLDATAPIWL
PPSEDPATTPPAHSVPVPATELGSTELVTTKTAGPEQP
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgaggggcgaggggcctgaggggcagagacaggccggccaccccgcagtgcctg
cagacccagtgcttcgacccgctggttcgcaaatgtgtggcctgcagtctcctccggacg
acagagcctagaccggcaggcggcccgagcagcctggcgcccgggacggcgctgcagccg
caggaggccctggtcctgctgggcctggtgagcgggaggcgccgacggcgacggcccggc
acggcggctgccccagaggccctggaggccccggacggagaccaggatgccccagagccc
ctggacagtgacagcatcctctccccgggaaccctggatgccacagctcccatctggctt
ccgcccagtgaagacccagctaccaccccacctgcccacagcgtccctgtgccagccaca
gagctgggttccactgagctggtgaccactaagacggccggcccggagcaaccgtag

DBGET integrated database retrieval system