KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002319Help
Entry
103002319         CDS       T03086                                 

Gene name
DARS2
Definition
(RefSeq) aspartyl-tRNA synthetase 2, mitochondrial
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103002319 (DARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bacu01007]
    103002319 (DARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bacu03016]
    103002319 (DARS2)
   03029 Mitochondrial biogenesis [BR:bacu03029]
    103002319 (DARS2)
Enzymes [BR:bacu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     103002319 (DARS2)
Amino acid related enzymes [BR:bacu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   103002319 (DARS2)
Transfer RNA biogenesis [BR:bacu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103002319 (DARS2)
 Prokaryotic Type
   Other AARSs
    103002319 (DARS2)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    103002319 (DARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 103002319
NCBI-ProteinID: XP_007165405
UniProt: A0A383YRB3
Position
Un
AA seq 652 aa AA seqDB search
MFCWLSRLFRGLSRPTRRTTQLIWGSFSRSLVLSSQRRIPELSSFVARTNTCGELRSSYL
GQEVTLCGWIQYRRQNIFLVLRDFHGLVQVIIPQDESAASVKKILCEAPMESVVQVSGTV
ISRPPGQENPKMPTGEIEIKVKTAKLLNSCKKLPFEIKDFVKKTEALRLRYRYLDLRGVQ
MQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFVIPSREPGKFYSLPQS
PQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVEQTGIQSLIEGLLQ
YSWPSDKDPVVVPFPSMTFAEALASYGTDKPDTRFGMKIVDISDMFRNTKVGFLQDALSK
PQGTIKAICIPEGEKYLKRKDIESIRKFAADHFNQEVLPIFLKTNNNWNSPVAKFIMEEQ
GLGLIRLLETQEEDVVLLTAGEHKKACSLLGKLRLECADLLEARGVVLRDPALFSFLWVV
DFPLFFPKEENPEELEAAHHPFTAPHPSDIHLLYTEPQKVRSQHYDLVLNGSEIGGGSIR
IHDAELQHYILATVLKEDVKLLSHLLQALDYGAPPHGGIAIGLDRLTCLVTGAPSIRDVI
AFPKSFQGHDLMSNAPDSIPPEELKPYHIQVSWPTDSETEKSSLNHPCHPES
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgttctgttggttaagtcggctgttcaggggtttatccagacccactagaaggaccaca
cagctgatctggggttctttctcccgaagtctggtactgagttcacagaggagaattcca
gaactcagtagctttgttgcccggaccaacacgtgtggagagttgcgttcttcttactta
ggccaagaagtcaccttgtgtggatggattcagtaccgaaggcaaaacatcttcctggtc
ctaagagatttccatgggcttgttcaagttatcattcctcaggatgagtcggctgcttct
gtgaagaagattttatgtgaagcgcccatggaatctgtggtgcaagtgtccgggacagta
atttcccgacctccaggacaagagaatccaaaaatgccaacaggtgagattgaaatcaaa
gttaaaacagctaaacttctgaattcctgcaagaagctgccctttgaaattaaggacttt
gtgaagaaaacagaagctcttcgtttgcggtatcgctacttagatttgcgtggtgtccaa
atgcagtataacctgcgactgaggtcccagatggtcatgaaaatgcgggaatatctctgt
aatctacatgggtttgtggatatagaaacaccaacattatttaaaaggactccagggggt
gcaaaagagtttgtaataccatccagggaacctggaaagttttattctctccctcagagt
cctcagcagtttaagcagcttctgatggttggtggtttagacagatattttcaagttgcc
cgatgttatcgagatgaaggatcaagaccagacagacagcccgaatttactcagattgac
atagagatgtcctttgtagaacagactggcatccagagtctaattgagggtttgctccag
tattcatggcccagtgacaaagatcctgtggtggttccttttccttctatgacttttgct
gaggcgttggccagctatggaactgataaacctgacactcgctttgggatgaagattgta
gatatcagtgatatgttcagaaacacaaaggttggatttcttcaggatgcgcttagtaaa
ccccaaggaaccatcaaagccatatgtatccctgaaggagaaaaatacttaaaaaggaaa
gacattgagtccattagaaaatttgcagctgaccattttaatcaggaagtcttacctata
ttcttgaaaaccaataacaactggaattctccagttgctaagttcataatggaggagcaa
ggcttgggactaatcagactgttggagacccaagaggaggatgtggtcctactaactgcc
ggagagcataagaaagcatgctctttgttgggaaaattacgactggagtgtgctgacctt
ctagaagcaagaggagtggtgcttcgtgacccagctctgttctctttcctttgggttgtg
gatttccccctcttctttcccaaggaggaaaatcccgaagagctggaggcagcccatcac
ccatttactgctccccaccccagtgacatccacctcctttacactgagccccaaaaggtc
cgtagccaacactatgacttggttttaaacggcagtgagataggaggtggttctatccga
attcatgatgcagagctacagcattacatcctggcaacagtactaaaggaagacgtgaaa
ttgctctcccatctgctccaggctttagattatggggcgccccctcatggaggaattgcc
atagggttagacagactgacgtgccttgtcactggagcgccaagcatcagagatgtcata
gccttccccaagtctttccagggccacgaccttatgagcaatgccccagattctatcccg
cctgaggaactgaagccctatcatatccaggtctcctggccaacagactcagaaacagaa
aagagctcattgaatcatccatgccatccagaaagttga

DBGET integrated database retrieval system