KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002335Help
Entry
103002335         CDS       T03086                                 

Gene name
DOCK6
Definition
(RefSeq) dedicator of cytokinesis 6
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103002335 (DOCK6)
Membrane trafficking [BR:bacu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103002335 (DOCK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 103002335
NCBI-ProteinID: XP_007169265
Position
Un
AA seq 440 aa AA seqDB search
MLASYTQSASVSDSLRRTVAAEVRKQVSRERSGSPHSSRRCSSSLGVPLTEVIEPLDFED
VLLSRPPDAEPGPLRDLVEFPADDQELLLQPRECRTTEPGIPEDGKLDAQVRAAVEMYTE
DWIIAHRRYQHLSAAYSPITMETQRERQKGLTRQVFEQDASGDERSSPEDSDDPRHSSGS
PDDTPRSSGASGIFDLRNLAADSLLPSLLERAAPEDVDRRNEALRRQHRPRALLALYPAP
DEDEAVERCSRPEPPREHFGQRILVKCLSLKFEIEIEPIFGILALYDVREKKKISENFYF
DLNSDSMKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFLVIKLEKVLQQGDISECCEPY
MVMKEVDTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHLANISADPPGLTAAVGGP
RTGQVAGTTPAASPASAQPR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcttacacacagtcagcctcagtctcagactccctgagaaggacagtggct
gctgaggtgcggaagcaggtgtcccgggaacgcagtggctctccccactccagcaggcgc
tgcagcagctccctgggggtcccactgactgaagtcattgagcccctggactttgaggat
gtgctcctgagccggccgccagatgcagagcccgggccactccgggacctggtcgagttt
ccagctgatgaccaggagctgctgctgcagccccgggaatgccgcaccacggagcctggg
atccccgaggatggaaagctggatgcccaggtgagggctgctgtggagatgtacacggag
gactggatcatcgcccacaggaggtaccagcacctgagtgcagcatacagccccatcacc
atggagacgcagcgagagaggcagaagggcctcacccgccaggtcttcgagcaggacgct
tctggggatgagaggtccagcccggaggactcggatgacccccggcactcctcaggctcc
ccagacgacaccccacgaagcagtggcgcctctggcatctttgacctgaggaacttggca
gctgactcattgctgccctcactgctggagcgcgcagccccggaggacgtggaccggcgc
aatgaggccctgcggcggcagcaccggccccgtgccctgctcgccctctacccggcgccc
gacgaggatgaggccgtggaacgctgcagccgcccggagccaccccgagagcacttcgga
cagaggatcctggtcaagtgcctgtcgcttaagttcgagatagaaatcgagcccatcttt
ggcatcttggccctgtacgatgtgcgggagaaaaagaagatctcggagaacttctacttt
gacctgaactcagactccatgaagggcctactgcgggcccatggcacccatcctgccatc
tccaccctggcccgctctgccatcttctccgtgacctatccctcgcccgacatcttcttg
gtcatcaagctggagaaggtgctgcagcagggggacatcagcgagtgctgcgagccctac
atggtgatgaaggaggtggacacagccaagaacaaagagaagctagagaagctgcgcctg
gcggctgagcagttctgcacccgtctgggccgctaccgcatgcccttcgcctggacggcg
gtgcacctggccaacattagcgccgacccacctggactgaccgccgccgtcgggggcccc
aggaccggacaagtagcggggacgacgcctgcagcttctccggcttccgcccagccacgc
taa

DBGET integrated database retrieval system