KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002388Help
Entry
103002388         CDS       T03086                                 

Gene name
ACVR2A
Definition
(RefSeq) activin A receptor type 2A
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04350  TGF-beta signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103002388 (ACVR2A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103002388 (ACVR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103002388 (ACVR2A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103002388 (ACVR2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103002388 (ACVR2A)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103002388 (ACVR2A)
Protein kinases [BR:bacu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103002388 (ACVR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal FTA2 APH
Motif
Other DBs
NCBI-GeneID: 103002388
NCBI-ProteinID: XP_007183092
UniProt: A0A384A711
Position
Un
AA seq 513 aa AA seqDB search
MGAAAKLAFAVFLISCSSGAILGRSETQECIFYNANWERDRTNRTGVESCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNERFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgctgcaaagttggcgtttgccgtctttcttatctcttgttcttcaggtgct
atacttggtagatcagaaactcaggagtgtattttctataatgctaattgggaaagagat
agaaccaatcgaactggtgttgaatcctgttatggtgacaaagataaacggcggcattgt
tttgctacctggaagaatatttctggttccattgaaatagtgaagcaaggttgttggctg
gatgatatcaactgctatgacaggactgattgtatagaaaaaaaagatagccctgaagta
tatttttgttgctgtgagggcaatatgtgtaatgaaaggttttcttattttccggagatg
gaagtcacacagcctacttcgaatccagttacaccaaagccaccctattacaacatcttg
ctctattctttggtgccacttatgctaattgcggggattgtcatttgtgcgttttgggtg
tacaggcatcataagatggcttaccctcctgtgcttgttccaactcaagacccaggacca
cccccaccttctccattactaggtttgaagccactgcagttactagaagtgaaagcaagg
ggaagatttggttgtgtctggaaagcccagttactcaatgaatatgtggctgtgaaaata
tttccaatacaggacaaacagtcatggcagaatgaatatgaagtctatagtttgcctgga
atgaagcatgagaacatattacagttcattggtgcagaaaaacgaggcaccagtgttgat
gtggatctttggctaatcacagcatttcatgaaaagggttcactatcagactttcttaag
gctaatgtggtctcttggaatgaattgtgtcatattgcagaaaccatggctagaggattg
gcatatttacatgaggatatacctggcctaaaagatggccacaaacccgccatatctcac
agggacatcaaaagtaaaaatgtactgttgaaaaacaatctgacagcctgcattgctgac
tttgggttggcgttaaaatttgaggctggcaagtctgcaggtgatacccatggacaggtt
ggtacccgaaggtatatggctccagaggtattagagggtgctataaacttccaaagggat
gcatttttgaggatagatatgtacgccatgggattagtcctgtgggaactggcttctcgc
tgtactgctgcagatggacctgtagatgagtacatgttgccatttgaggaggaaattggc
cagcatccctctcttgaagacatgcaggaagttgttgtgcataaaaaaaagaggcctgtt
ctaagagattattggcagaaacatgctggaatggcaatgctctgtgaaacgatagaagaa
tgttgggatcacgatgcagaagccaggttatcagctggatgtgtaggtgaaagaattact
cagatgcaaagactaacaaatatcattaccacagaggacattgtaacagtggtcacgatg
gtgacaaatgttgactttcctcccaaagaatctagtctatga

DBGET integrated database retrieval system