KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002687Help
Entry
103002687         CDS       T03086                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  transforming growth factor beta-1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04218  Cellular senescence
bacu04350  TGF-beta signaling pathway
bacu04380  Osteoclast differentiation
bacu04390  Hippo signaling pathway
bacu04659  Th17 cell differentiation
bacu04672  Intestinal immune network for IgA production
bacu04926  Relaxin signaling pathway
bacu04932  Non-alcoholic fatty liver disease (NAFLD)
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05140  Leishmaniasis
bacu05142  Chagas disease (American trypanosomiasis)
bacu05144  Malaria
bacu05145  Toxoplasmosis
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05220  Chronic myeloid leukemia
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05321  Inflammatory bowel disease (IBD)
bacu05323  Rheumatoid arthritis
bacu05410  Hypertrophic cardiomyopathy (HCM)
bacu05414  Dilated cardiomyopathy (DCM)
Module
bacu_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103002687 (TGFB1)
   04350 TGF-beta signaling pathway
    103002687 (TGFB1)
   04390 Hippo signaling pathway
    103002687 (TGFB1)
   04068 FoxO signaling pathway
    103002687 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103002687 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103002687 (TGFB1)
   04218 Cellular senescence
    103002687 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103002687 (TGFB1)
   04672 Intestinal immune network for IgA production
    103002687 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103002687 (TGFB1)
  09158 Development
   04380 Osteoclast differentiation
    103002687 (TGFB1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    103002687 (TGFB1)
   05205 Proteoglycans in cancer
    103002687 (TGFB1)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    103002687 (TGFB1)
   05212 Pancreatic cancer
    103002687 (TGFB1)
   05225 Hepatocellular carcinoma
    103002687 (TGFB1)
   05226 Gastric cancer
    103002687 (TGFB1)
   05220 Chronic myeloid leukemia
    103002687 (TGFB1)
   05211 Renal cell carcinoma
    103002687 (TGFB1)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    103002687 (TGFB1)
   05321 Inflammatory bowel disease (IBD)
    103002687 (TGFB1)
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    103002687 (TGFB1)
   05414 Dilated cardiomyopathy (DCM)
    103002687 (TGFB1)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103002687 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103002687 (TGFB1)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    103002687 (TGFB1)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    103002687 (TGFB1)
   05161 Hepatitis B
    103002687 (TGFB1)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    103002687 (TGFB1)
   05144 Malaria
    103002687 (TGFB1)
   05145 Toxoplasmosis
    103002687 (TGFB1)
   05140 Leishmaniasis
    103002687 (TGFB1)
   05142 Chagas disease (American trypanosomiasis)
    103002687 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bacu03110]
    103002687 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103002687 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103002687 (TGFB1)
Chaperones and folding catalysts [BR:bacu03110]
 Intramolecular chaperones
  Others
   103002687 (TGFB1)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103002687 (TGFB1)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   103002687 (TGFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 103002687
NCBI-ProteinID: XP_007168073
UniProt: A0A383YYX6
Position
Un
AA seq 406 aa AA seqDB search
MPPSGLRLLPLLLPLLWPLVLPPSRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVENSNEI
YGKIKRSPHSMYMLFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNDSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLTHGEVIEGFRLSAHCSCDSKDNTLQVDINGFS
SGRRGDLATIHGMNRPFLLLMATPLERAQHLHSPRHRRALDTNYCFRVCKGDRDGDRAGG
QPGSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYN
QHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctgctgccgctgctgctgccgctgctgtggccactagtg
ctgccgcctagccggccggccgccggactgtccacctgcaagaccatcgacatggagctg
gtgaagcgaaagcgcatcgaggccatccgcggccagattctgtctaagcttcggctcgcc
agccccccgagccagggggaggtgccgcccggtccgctgcccgaggccgtactggccctt
tacaacagtacccgtgaccgggtggccggggaaagtgccgaacctgagcctgagccagag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaacagcaacgaaatc
tatgggaaaatcaagcgtagcccacacagcatgtatatgctcttcaacacatcggagctc
cgggaagcggtgcccgaacctgtgttgctctctcgggcagagctgcgcctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaatgattcctggcgc
tacctcagcaaccggctgctggcccccagcgactcaccggagtggctgtcctttgatgtc
actggagttgtgcggcagtggctgacccacggagaggtaatagagggctttcgcctcagt
gcccactgttcctgtgacagcaaagataacacactccaagtggacattaacgggttcagt
tccggccgccggggtgacctcgccaccattcatggcatgaaccggcccttcctgctcctc
atggccaccccgctggagagggcccagcacctgcacagcccccggcaccgccgagccctg
gacaccaactactgcttcagggtttgcaagggagaccgagatggagaccgtgctggcggg
caaccaggctccacggaaaagaactgctgcgttcggcagctctacattgacttccgcaag
gacctgggctggaagtggattcacgaacccaagggctaccacgccaatttctgcctgggg
ccttgcccctacatctggagcctggacacgcagtacagcaaggtcctggccctgtacaac
cagcacaacccgggagcgtcggcggcgccgtgctgcgtgccgcaggcgctggagcctctg
cctatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtccaacatgatcgtg
cgctcctgcaagtgcagctga

DBGET integrated database retrieval system