KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003703Help
Entry
103003703         CDS       T03086                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine palmitoyltransferase 1C
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00071  Fatty acid degradation
bacu01212  Fatty acid metabolism
bacu03320  PPAR signaling pathway
bacu04152  AMPK signaling pathway
bacu04714  Thermogenesis
bacu04920  Adipocytokine signaling pathway
bacu04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103003703 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103003703 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103003703 (CPT1C)
   04920 Adipocytokine signaling pathway
    103003703 (CPT1C)
   03320 PPAR signaling pathway
    103003703 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    103003703 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bacu03029]
    103003703 (CPT1C)
Enzymes [BR:bacu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     103003703 (CPT1C)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103003703 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 103003703
NCBI-ProteinID: XP_007185006
UniProt: A0A384ACB8
Position
Un
AA seq 801 aa AA seqDB search
MAEAHQAVGFRPSLTSDTGEVELSAPMLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHRLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLQPHGAMSSRTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPVLSDEDFDWTATLAREFLRLQASLLQWYLQLKSWWASNYVSDWWEEFV
YLRSRNSLMVNSNYYMMDFLYVTPTPVQAARAGNAVHALLLYRHRLNRQEILPTLLMGMR
PLCSAQYEKIFNTTRIPGVHKDHIRHLRDSRHVAVFHRGRFFRVGTHSQSGLLSPRALEQ
QFQRILDDPSPACPHEEHLAALTAAPRDMWAQVRRSLKTQAQEALEAVEGAAFFVSLDSE
PAGLTREDPAASLDTYAHALLAGRGHDRWFDKSFSLIVFSNGKLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSADGHCKGHPDPSLPQPQRLHWDLPDKIHLSISLALRGAKTLSGN
IDCHVFPFSHFGKSFIKRCHLSSDSFIQMALQLAYFRDRGQFCLTYESTMTRLFLEGRTE
TVRSCTREACNFVRAMEDKEKTDPQCLALFRLAVDKHQALLKAAMSGQGVDRHLFALYIV
SQFLHLQSPFLDQVHSEQWQLATSQIPVQQIHLFDVHSYPDYVSSGGGFGPADDHGYGVS
YIFMGDDVITFHISSKKSSTRTDSHRLGQHIEDALLDVAALFQEGQRLKRRGLAEEGSEH
SRDSLPCHTRGSRAPTTATNF
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgcaccaggccgtgggcttccgaccctcgctgacttcggacacaggagaa
gtggagctcagtgccccgatgttgcaagagatctacctctccggactgcgctcttggaaa
aggcatctgtcccgtttctggaacgattttctcacaggtgtgttccctgctagccccctc
agctggctgttcctcttcagtgcaatccagcttgcctggttcctccagttggatccttcc
ttaggactgatggagaaaatcaaagagttgctgccagactggggtggacagcatcacagg
cttcggggggtcctggcggccgcgctgtttgcttcgtgtctgtggggagctctgatcttc
acgcttcatgtggccctgaggctacttctgtcctaccacggctggctcctccaaccccac
ggagccatgtcctcacgcaccaagacctggctggccctggttcgcatcttctccggccgc
cacccaatgctcttcagttaccaacgctccctgccgcgtcagcctgtgccctccgtgcag
gacaccgtgcgcaagtatctggagtctgtccgacccgtcctctccgacgaggacttcgac
tggaccgcgaccctagcacgggaattcctgaggctgcaggcgtcactgctgcagtggtac
cttcagctcaagtcctggtgggcgtccaattatgtcagcgactggtgggaagaatttgtg
tacctgcgctcccggaactcactgatggtgaatagcaactactatatgatggacttcctg
tatgtcacgcccactcccgtgcaggccgcccgtgcggggaacgcagtccacgccctcctt
ctgtaccgccaccgcctgaaccgccaggagatcctgccgactttgctgatgggaatgcgg
cccttgtgctctgcccagtatgagaagatattcaacaccacgcgaattcccggggtccac
aaagaccacatccgccaccttcgtgacagcagacacgtggccgtcttccaccggggccga
ttcttccgcgtggggacccactcccagagtggcctgctttccccgcgggccctggagcag
cagttccagcgaatcctggacgacccctctcctgcctgcccccacgaggagcatctggcg
gccttgaccgctgctccgagggacatgtgggcccaggtgcggaggtccctgaagacccag
gcccaggaggccctggaggccgtcgaaggggctgctttctttgtatcactcgactctgag
cccgcggggctcaccagggaggaccctgcagcttccttagacacctatgcccacgccctg
ctggccggcaggggccacgaccgctggtttgacaaatccttctccttaatcgtcttctcc
aacgggaagctgggcctcagcgtggagcactcgtgggctgactgccccatctcaggacac
atgtgggagttcactctggccacagaatgctttcagctgggctactcggcagacggtcac
tgcaagggacaccctgacccctcactgccccagccccagcggctgcactgggaccttcca
gacaagatccatctatccatctctctagccctgaggggagccaagaccttgtctggaaac
atcgactgccacgtcttccccttctcccacttcggcaagagcttcatcaaacgctgccac
ctctcttcagacagcttcatccagatggccttgcagctggcctactttcgggacaggggt
caattctgcctgacttatgagtcgaccatgactcgcttgttcctggaagggcggacagag
acggtgcgttcttgcacgagggaggcctgcaactttgtgagagccatggaagacaaagag
aagacagacccacagtgcctcgccctgttccgcttggcggtggacaagcaccaagccctg
ctgaaggcagcgatgagtggacagggggtcgaccgccacctctttgctctctacatcgtg
tcccagttcctccacctgcagtctcccttcctggaccaggttcactcggagcagtggcag
ctggctaccagccagattcctgttcagcaaatccacctgttcgacgtccacagttacccc
gactatgtttcctctggtggtggattcgggcctgctgatgaccatggttatggtgtttcc
tacatcttcatgggggatgatgtgatcaccttccacatctccagcaaaaaatcaagcaca
agaacggactcccaccggctggggcagcacatcgaggatgcattgttggacgtggccgcc
cttttccaggaggggcagcgtcttaagcgcagagggttagcggaggagggctcggagcac
agccgtgactctctcccctgccataccaggggctccagggcacccacgacagccactaac
ttttga

DBGET integrated database retrieval system