KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004095
Entry
103004095         CDS       T03086                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103004095 (AHRR)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    103004095 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 103004095
NCBI-ProteinID: XP_007191724
UniProt: A0A384AX85
Position
Un
AA seq 697 aa
MIPPGECLYAGRKRRKPIQKQRPAMGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIISK
LDKLSVLRLSVSYLRVKSFFQVSGEQTLQQPAAGAPSPGDRDPRGGSAVLEGRLLLESLH
GFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQA
GCGQNLLSETGEDAVLGRLLRAQEGAAGWPTEYSAFLTRCFICRVRCLLDSTSGFLTMQF
QGKLKFLFGQKRRAPSGTALPPRLSLFCVVAPLPTAVKMQSVCLRAKHRVDVSATPDTKA
KAAASLCEPELHGKPNYLAGRSNGENGLSVFRMPADACHWGRLATRAPCLCLRGGHDLLL
QPEGAAGDGRGEELGGVPRGPSCPRERRDVLPYSCHLETQGPSKHLNWTPGRHGQDGGTK
LKLEPGKGDPFPAAPARGACLPYPGTQGTVHAVRSSPGSHQPKPPPGACAGRTSRALRDG
PQGQAAPPTSCPFPQGSLEDGLPRPGGQRLPAGCYPTEDKLRGVPMPPGAPCNPVLSLDV
PIKMESESGSEDAADGYSVSPSQAWLGASDVAKRQLVTFPTRMHLKTEPDSRHPLYSPPL
GPGLLGAQPRPGRELAPLHPAHCACLEPPPRLCAGGHQPPSLGCDCHAPGPAPVVKLEPL
DSPPWAAHSQGGAPGILPRSTLATRMPPRDPECTFLP
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgattccgccgggggagtgcctgtatgccgggaggaaaagaaggaagcccattcagaaa
cagaggcccgccatgggcgccgagaagtcgaacccttccaagagacaccgggatcgcctc
aacgccgagctggaccacctagccagcctgctgccactgccacccgacatcatctctaag
ctggacaagctttcggtcctgcgcctcagcgtcagttacctccgggtgaagagcttcttc
caagtttctggggagcagaccctgcagcagccggcggccggtgccccctcaccaggagac
agggacccgcgtggagggtctgccgtgctggagggaaggctgctgctggagtccctccac
ggctttgctctggtggtaagcgcggaagggatgatattctacgcgtcagcaacgattgtg
gactatctgggcttccaccagacggacgtgatgcaccaaaatatttacgactacatccac
gtggacgaccgccaggacttctgccggcagctgcactgggccatggaccctccccaggct
gggtgtgggcagaacctgctctcagagacaggagaggacgccgtcctggggaggctgctc
cgggcccaggagggggccgcgggctggcccaccgagtactcggccttcctgacgcgatgc
ttcatttgccgcgtgcgctgcttgctggacagcacctcaggcttcctgacgatgcagttt
caagggaaactaaaattcctgttcgggcagaagaggagggccccgtcgggcaccgccctg
ccccctcggctctccctgttctgcgtcgtggcgcccctgcctaccgcggtgaagatgcag
agcgtgtgtctgagggcgaagcacagggtagacgtctcggccacgccggacacgaaagca
aaagctgccgcaagtctctgtgaaccagaattgcacggaaaacccaattacttagcaggg
aggagcaacggagaaaatggcctgtccgtgttcaggatgcccgcggacgcctgccactgg
ggccggcttgcaacccgggccccctgcctgtgcctccggggcggccacgacctcctcctc
cagcccgagggggccgcaggggatgggcgaggagaggaactagggggggtgccgaggggc
ccctcctgcccaagggagcggagggacgtccttccgtacagctgccacctcgagacacag
ggaccctcgaagcacctgaactggacgccggggagacatggtcaggacggcggcaccaag
ctgaagctggagcccggcaagggcgacccgttccccgccgcgccggcccgaggcgcctgc
ctgccctacccgggcacacagggcactgtccacgccgtcagaagttcgcctggctctcac
cagccaaagcctccccccggggcctgcgccggccggaccagcagagccttgcgggatggc
ccccagggccaggctgcccctcccaccagctgccccttccctcaggggagcctggaggac
gggcttcctcggccgggagggcagcgtctccctgcggggtgctatcccaccgaggacaag
cttcgaggcgtcccaatgcccccgggagccccgtgtaaccccgtattgtcactcgatgtg
cccatcaagatggagagcgaatccgggtccgaggatgcggcagacggctactctgtgtcc
ccgagccaggcgtggctgggggccagcgacgtggccaagagacagctggtcactttcccg
accaggatgcacctgaagacggagccggactccaggcaccccctctacagcccgcccctg
gggcctggcctgctgggggcccagcccaggcccggcagggagctggccccgttgcacccc
gcacactgcgcctgcctggagcctccgccccgcctctgtgctgggggccaccagcccccc
agcctgggctgtgactgccacgctcccgggcctgcgcccgtggtcaagcttgagcccctg
gactcgcccccgtgggccgctcacagccagggcggggcgcccgggatactccccaggagc
accttggcgacacggatgccacccagagaccccgagtgcacattcctgccgtag

DBGET integrated database retrieval system