KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004912Help
Entry
103004912         CDS       T03086                                 

Gene name
FKBP6
Definition
(RefSeq) FK506 binding protein 6
  KO
K09572  FK506-binding protein 6 [EC:5.2.1.8]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bacu03110]
    103004912 (FKBP6)
Enzymes [BR:bacu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103004912 (FKBP6)
Chaperones and folding catalysts [BR:bacu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    103004912 (FKBP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_2 TPR_12 TPR_19 TPR_10 TPR_11 TPR_16
Motif
Other DBs
NCBI-GeneID: 103004912
NCBI-ProteinID: XP_007186614
UniProt: A0A384AHA3
Position
Un
AA seq 327 aa AA seqDB search
MGGSARNPGVLQRDDAPSQSPYQRLSQRMLDLSGDRGVLKDVIREGSGELVTPDASVLVK
YSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPTYAYGM
LGCPPLIPPNTTVLFEIELLDFLDSAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNY
LFRQNRFYDAIVRYKQALLLLHRRSVPLEEQHLVETAKLLVLLNLSFTYLKLERPAVALR
YGEQALSIDQKNAKALFXXSQACLLMTEYQKARDFLVRAQKEQPFNHDINNELKKLASYY
RDYMGKEKEMCHRMFAPGEHGSTVGEN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggggggcagcgcccggaacccgggagtcctgcaaagggacgacgcccccagccagtct
ccgtaccagcggttaagtcaaaggatgctggacctttccggggaccggggcgtgctgaag
gatgtcatccgagagggttctggagagctggtgacaccggacgcttcggtgctcgtgaaa
tattctgggtatctggagcacatggacaagccttttgattccaattgctttaggaaaacc
cctcggctcatgaaacttggagaggatatcacactttggggcatggagctgggccttctg
agcatgcggagaggagagctggccaggtttctgttcaaaccgacctatgcttacggaatg
ctgggctgtcctcccctgatccccccaaacactaccgtcttgttcgagatcgagctgctt
gacttcctggattctgctgagtcagacaagttttgtgccctctcagccgagcaacaggat
cagtttccacttcagaaggtcctaaaagtggcagctactgaacgggagtttggcaactac
cttttccgccaaaatcgtttctatgatgccatagtgagatataaacaggccttgttgctt
ctccaccggcgatcagtaccccttgaagagcagcacctggtggagaccgccaagctgctt
gtcctccttaacctatccttcacgtacctgaagctggagcgacctgccgtggccctgcgc
tatggagagcaggctctgagcattgaccagaagaacgccaaggccctcttccnnntgagt
caggcctgtctcctcatgactgagtatcagaaggcccgggattttctagtccgagcccag
aaggaacagcccttcaatcatgacatcaataacgagctgaagaaactggccagctattac
agggattacatgggtaaagagaaagaaatgtgtcaccgaatgtttgctcctggtgaacat
ggctctacagtaggagaaaactaa

DBGET integrated database retrieval system