KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005549
Entry
103005549         CDS       T03086                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04727  GABAergic synapse
bacu04742  Taste transduction
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05032  Morphine addiction
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103005549 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103005549 (ADCY4)
   04371 Apelin signaling pathway
    103005549 (ADCY4)
   04020 Calcium signaling pathway
    103005549 (ADCY4)
   04072 Phospholipase D signaling pathway
    103005549 (ADCY4)
   04024 cAMP signaling pathway
    103005549 (ADCY4)
   04022 cGMP-PKG signaling pathway
    103005549 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103005549 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103005549 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103005549 (ADCY4)
   04062 Chemokine signaling pathway
    103005549 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    103005549 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    103005549 (ADCY4)
   04912 GnRH signaling pathway
    103005549 (ADCY4)
   04913 Ovarian steroidogenesis
    103005549 (ADCY4)
   04915 Estrogen signaling pathway
    103005549 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    103005549 (ADCY4)
   04921 Oxytocin signaling pathway
    103005549 (ADCY4)
   04926 Relaxin signaling pathway
    103005549 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    103005549 (ADCY4)
   04918 Thyroid hormone synthesis
    103005549 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    103005549 (ADCY4)
   04916 Melanogenesis
    103005549 (ADCY4)
   04925 Aldosterone synthesis and secretion
    103005549 (ADCY4)
   04927 Cortisol synthesis and secretion
    103005549 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103005549 (ADCY4)
   04270 Vascular smooth muscle contraction
    103005549 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    103005549 (ADCY4)
   04971 Gastric acid secretion
    103005549 (ADCY4)
   04972 Pancreatic secretion
    103005549 (ADCY4)
   04976 Bile secretion
    103005549 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    103005549 (ADCY4)
   04727 GABAergic synapse
    103005549 (ADCY4)
   04725 Cholinergic synapse
    103005549 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    103005549 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    103005549 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    103005549 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    103005549 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    103005549 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103005549 (ADCY4)
   04714 Thermogenesis
    103005549 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103005549 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    103005549 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    103005549 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103005549 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103005549 (ADCY4)
   05163 Human cytomegalovirus infection
    103005549 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103005549 (ADCY4)
Enzymes [BR:bacu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103005549 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 103005549
NCBI-ProteinID: XP_007180701
UniProt: A0A384A041
Position
Un
AA seq 1109 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLFGLLALLAVAWASGRELASDPG
FLTTMLCGLGGFSLLLGLASREQRLQRWTRPLSGLVWAALLALGHGFLFTGGVVSAWDQV
SFFLFVIFTVYAMLPLGMRDAAAAGLASSLSHLLVLGLYLGPQPDSQPALLPQSPPQPSQ
RPIQLHTIAPRPRGPAPSEADPSAQLAANAVLFLCGNVAGAYHKALMERALRATFREALS
SLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKR
HQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVS
GLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDV
WSHDVTLANHMEASGVPGRVHITGATLALLAGAYAVEDAAMEHGDPYLRELGEPTYLVID
PRAKEEDEKGTAGGLLSSLEGPKMRPSLLMTRYLESWGAAKPFAHLSHVESPVSTSTPLP
EKALSSFSPQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSEDFNPLTLYFR
EKEMEKEYRLSALPAFKYYAACTFLVFFSNFIIQMLVTNRPPALTITYSITFLLFFLLLF
VCFSEHLTKCVLKGPKMLHWLPTLSVLVATRPGLRVALGTATILLIFSMAITSLVFLPAA
SNCPFRAPNVSSTASNLSWELPGSLPLISVPYSMHCCVLGFLSCSLFLHMSFELKLLLLL
LWLAASCSLFLHSHAWLSDCLIARLYLGTLDSRPGVLKEPKLMGAISFFIFFFTLLVLAR
QNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQS
YECVCVLFASVPDFKEFYSESSINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIC
STYMAATGLNATSGQDAQQDAEQSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLN
HGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETACALQSLGYTCYSRGI
IKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3330 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccgcggccgcctcccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccactgctgctactgctgctggtgatcgtgctcttcggg
ctcttggcgctgctcgctgttgcctgggccagtggcagggagctggcctcagacccgggc
ttcctgaccactatgctgtgtgggctgggcggcttctcgctgctgctgggcctggcttcc
cgcgagcagcgactgcagcgctggacgcgtcccctgtcgggcctcgtgtgggcagcgctg
ctcgcgctaggccacggcttcctcttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctttttcctttttgtcatcttcaccgtgtatgccatgttgcccttgggcatgcgggac
gccgccgccgcgggtctcgcctcttcactctcacacctgctggtcctcgggctgtatctt
gggcctcagccagactcacagcccgcgctgctgccgcagagtcctcctcagccctctcag
agaccaatccagctacacacaatagctccccgaccccggggtccagcgccctctgaggct
gacccttccgcacagctggcggcaaacgcggtgttgttcctgtgcgggaacgtggccgga
gcataccacaaggcgctgatggagcgcgccctgcgcgccacgttccgggaggcgctcagt
tccctgcactcccgccggagactcgacaccgagaagaagcaccaggaacaccttctcttg
tccatccttcctgcctacctggcccgagagatgaaggcggagatcatggcacggctgcag
gctggacaggggtcacggccagagagcaccaacaacttccacagcctctatgtcaagagg
caccagggagtgagcgtgctgtatgctgacatcgtgggcttcacgcggctggccagtgag
tgctcccctaaggagttggtgctcatgctcaacgagctctttggcaagttcgaccagatc
gccaaggagcatgaatgcatgcggatcaagatcctgggagactgttactactgtgtctct
gggctgccgctctcgctgccggaccacgccatcaactgcgtgcgcatggggctggacatg
tgccgggccatcaggaaacttcgggcagccactggcgtggatatcaacatgcgtgtgggt
gtgcactcgggcagcgtgctctgcggagtcatcgggctgcagaaatggcagtatgatgtc
tggtcccatgacgtcactctggccaaccacatggaggcgagtggagtgccaggacgagta
catatcacaggggctacgctggcactgctggcaggggcttatgctgtggaggatgcagcc
atggaacacggggacccataccttcgggagctaggggagccgacctaccttgtcatcgat
ccccgggctaaggaggaggacgagaagggcactgcaggcgggttactgtcctctcttgag
ggccccaagatgcgtccatcactgctgatgacccgctacttggagtcctggggtgcagcc
aagcctttcgcccacctgagccatgtggagagccctgtgtccacctccacccctctcccg
gagaaggccctgtcttccttcagcccccagtggagcctggaccggagccgtaccccccgg
ggactagatgatgaactagacaccggggatgccaagttcttccaagtcatcgaacagctc
aactctcagaaacagtggaaacagtcagaggacttcaacccattgacactgtacttcaga
gagaaggagatggagaaagagtatcggctctctgcactccccgccttcaaatactatgca
gcctgcaccttcctggtttttttctccaacttcatcatccagatgctggtgacaaacagg
cccccagctctgaccatcacctatagcatcaccttcctcctcttcttcctcctcctcttc
gtctgcttctcagagcacctgacgaagtgtgtcttgaaaggccccaagatgctgcactgg
ctgcccacactgtctgtcctggtggccacacggcctggactgcgagttgccctgggcacc
gctaccatcctgctcatcttctccatggccattaccagcctggtcttcttaccggcagca
tcaaactgccctttccgggctcccaatgtgtcctccacggcttccaacctctcctgggag
ctccctgggtccctgcctctcatcagcgtcccatactccatgcactgctgcgtgctgggg
ttcctctcctgctccctcttcctgcacatgagcttcgagctgaagctgctgctgctcctg
ctgtggctggcagcctcctgctccctcttcctgcactcccacgcctggctgtccgactgt
ctcatcgcccgcctctatctgggcaccttggactccaggccaggggtgctgaaggagcct
aaactgatgggagcgatctccttcttcatcttcttcttcaccctcctggtcctggctcgg
cagaatgagtattactgccgcctggacttcctgtggaagaagaaactgaggcaggagcag
gaggagacagagacgatggaaaacctgactcggctactcttggagaacgtgctccccgcg
cacgtagccccccagttcatcggccagaatcggcgcaacgaggacctctaccaccagtcc
tacgagtgtgtttgtgtcctcttcgcctcagtcccagactttaaggagttttactctgaa
tccagcatcaaccacgaggggctagagtgtctgcggctgctcaatgagataattgctgat
tttgatgagctgctctccaagcccaagttcagtggggtggagaaaatcaaaactatctgc
agcacctacatggcagctacaggcttgaacgccacctccggacaggatgcacagcaggat
gctgagcaaagctgcagccaccttggcaccatggtagagtttgccgtggcccttgggtct
aagctggacgtcatcaacaagcactcattcaacaacttccgcttgcgtgtggggttaaac
cacggacctgtagtggccggagtgattggggcccagaaaccacaatatgacatctggggc
aacacggtgaacgtggccagccgaatggagagtacaggcgtcctgggcaagatccaagtg
accgaagagacagcctgcgccctgcagtccttaggctacacctgctacagccggggcatc
atcaaggtcaaaggcaaagggcagctctgcacctacttcctgaacacagatttgacacga
actggacctccctcggccaccctaggctga

DBGET integrated database retrieval system