KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005919
Entry
103005919         CDS       T03086                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103005919 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bacu04040]
    103005919 (ASIC1)
Ion channels [BR:bacu04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   103005919 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 103005919
NCBI-ProteinID: XP_007179399
UniProt: A0A383ZWT1
Position
Un
AA seq 559 aa
MPIQIFCSVSFSSGEEAPGPLGDIWGPHQRQQRDNSESEEEGEEKEKEAERKGARERDLP
MDLVAFANSCTLHGASHIFVEGGPGPRQALWAAAFILALGAFLCQVGDRVAYYLSYPHVT
LLDEVATTELAFPAVTVCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAF
SGEPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRL
KTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAP
GFQTFVACQEQRLIYLPPPWGTCKAVTMDLDFFDSYSITACRIDCETRYLVENCNCRMVH
MPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKY
LAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILT
VLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTY
AANILPHHPARGTFEDFTC
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctctgtgtcattctcctctggagaggaggccccagggccc
ttgggagatatttggggtccccaccagcggcaacagcgggacaactcagaatcagaagag
gagggagaagagaaggaaaaggaggcagagaggaagggggccagagagagggacttaccg
atggacttggtggcctttgccaacagctgcacccttcatggagccagccacatctttgtg
gaagggggtccagggccacggcaggccctgtgggcagcggcctttatcctggcactgggt
gccttcttgtgccaggtcggggatcgagttgcctattacctcagctacccacatgtgact
ctgctagatgaagtggccacgacggagctggccttcccggcggtcaccgtctgcaacacc
aatgccgtgcggctctcccagctcagctaccccgacttgctctacctggcccccatgttg
gggctggatgaaagcgatgaccccggggtgcccctcgccccaccggggcccgaggccttc
tctggggagccctttaacctgcaccgcttctacaatcgctcctgccaccggctggaggac
atgctgctctattgctcctactgcggggggccctgtggccctcacaacttctcagtggtc
ttcacacggtatggaaagtgctacacattcaactctggccgagatgggcgtcccaggctg
aagaccatgaagggtgggacgggcaatgggctggagatcatgctggacattcagcaggac
gagtacctgcccgtgtggggggagaccgatgagacgtccttcgaagcgggcatcaaagtg
cagatccacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtagcccca
gggttccagacctttgtggcctgtcaagagcagcggctcatctacctgcccccgccctgg
ggcacctgcaaagctgttaccatggacttggatttcttcgactcctacagcattaccgcc
tgccgcatcgactgtgagacccgctacctggtggagaactgtaactgccgcatggtgcac
atgccaggggatgccccatactgcactccagagcagtacaaggagtgtgcagatcctgcc
ctggacttcctggtggagaaggaccaggagtactgtgtgtgtgaaatgccctgcaacttg
actcgctatggcaaggagctgtccatggtcaagattcccagcaaagcatcagccaagtac
ctggccaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggac
attttctttgaagtcctcaactatgagaccattgagcagaagaaggcctatgagatcgca
ggactcctgggtgacattggaggccagatgggtctgttcatcggggccagcatcctgact
gtgctggagctcttcgactacgcctacgaggtgattaaacacaagctgtgcagacgaggg
aagtgccagaaggaggccaaacggagcagcgcggacaagggcgtggccctcagcctggat
gacgtcaaaagacacaacccgtgtgagagcctccggggccatcctgccgggatgacgtat
gctgccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system