KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005981Help
Entry
103005981         CDS       T03086                                 

Gene name
ENOSF1
Definition
(RefSeq) enolase superfamily member 1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00051  Fructose and mannose metabolism
bacu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103005981 (ENOSF1)
Enzymes [BR:bacu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     103005981 (ENOSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N DUF2247 MAAL_C DUF2742
Motif
Other DBs
NCBI-GeneID: 103005981
NCBI-ProteinID: XP_007191649
UniProt: A0A384AX12
Position
Un
AA seq 466 aa AA seqDB search
MVRGRISRLSVRDVRFPTSLGGHGSDAMGGAFPLQHTDPDYSAAYVVLETDAEDGLKGYG
ITFTLGKGTEVVVCAVNALAPHLLNKDLGDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHL
ATAAVLNAVWDLWAKQEGKPLWKLLVDMDPRKLVSCLDFRYITDVLTEEEAYEILQKGQV
GKKEREEQMLAHGYPAYTTSCAWLGYSDATLKQLCSKALEDGWTRFKVKVGADLQDDIRR
CRLIRNMIGPEKTLMMDANQRWDVPEAVEWMAKLAEFKPLWIEEPTSPDDILGHATISKA
LVPLGIGVATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFDIPVC
PHAGGVGLCELVQHLIIFDFVSVSASLKDRIWLHLLVPSYISTCARMCEYVDHLHEHFKY
PVIIKKASYMPPKDAGYSTEMKEESVKKHQYPDGEVWEKLLAAQVN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcggcaggatctctcggctctcggtccgcgatgtgcgcttccccacgtcgctc
gggggccacggctcggacgctatggggggagcatttcccctgcagcacacagaccctgac
tactcagctgcctacgttgtcttggagacggatgcggaagatggactcaagggctacgga
atcaccttcactctggggaaaggcactgaagttgttgtctgtgctgtgaatgccctggcc
ccccacctgcttaacaaggaccttggggacattgttggtgatttcagaggcttctacaga
cagctcacgagcgacgggcagctcagatggatcggtcccgagaagggtgtggtgcatctg
gccacggcggccgttctcaatgccgtgtgggacctgtgggccaagcaggagggaaagcct
ctgtggaagttacttgttgacatggaccccaggaagctggtatcctgcctagattttagg
tacatcaccgacgtcctgacagaggaggaagcctatgaaatcctgcagaaaggtcaagtt
gggaaaaaagagcgagaagagcaaatgctggcgcatggctaccctgcctacaccacatcg
tgcgcctggctgggctactcggacgccacgctgaagcagctctgcagcaaggcgctggag
gacggctggaccaggtttaaggtaaaagttggtgctgatctccaggatgacatccgtaga
tgccgactcatcagaaacatgatcggccctgagaagacgctgatgatggatgccaaccag
cgctgggatgtgcccgaggccgtggagtggatggcgaagctggcggagttcaagcccctg
tggattgaggagcccacctcccctgatgacattctggggcatgccaccatttccaaggca
ctggtccccctgggaattggcgttgccaccggagaacagtgccacaacagagtgatattt
aagcaactcctacaggcaaaagccctgcagtttctccagatcgacagctgcaggctgggg
agtgtcaacgagaacctctcagtgctgctgatggccaaaaagtttgacattcctgtgtgc
ccgcatgctggtggagttggcctctgtgaactggtgcagcacctgattatatttgacttc
gtatcagtctctgcaagcctcaaagacaggatctggctgcatcttttagttccatcttat
atctcaacatgcgccaggatgtgtgaatacgtcgaccacctgcacgagcacttcaagtac
cccgtgataatcaagaaggcttcctacatgcctcctaaggatgctggttattcaacagaa
atgaaggaggaatctgtaaagaaacaccagtatccagatggtgaagtttgggagaagctc
cttgctgctcaagtgaattag

DBGET integrated database retrieval system