KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008158
Entry
103008158         CDS       T03086                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu05200  Pathways in cancer
bacu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103008158 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008158 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    103008158 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103008158 (MECOM)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    103008158 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_11 zf-BED zf-Di19 PyrI_C Zn-ribbon_8 zinc_ribbon_15 zf-C2H2_8
Other DBs
NCBI-GeneID: 103008158
NCBI-ProteinID: XP_007197604
UniProt: A0A384BE95
Position
Un
AA seq 832 aa
MPAEFELRESNMPGAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDPSYGWEILDEFCNVKF
CIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLLMKSEDYP
HDTMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHTAFSMVEEDFQQKLDSEND
LREIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDS
GKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVK
PFISFSQSMYPFPDRDLRSLPLKMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTPVP
AKPPVTPATSQDQPLDLSMGSRSRASGTKLTEPRKNHVFGEKKGGNGEPRPASDGSLQHA
RPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQMSAIENMAEKLESFSALKP
EASELLQSVPSMFNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQ
PYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSG
TATSSPHSELESTGAILDDKEDAYFTEIRNFIGNSNHSSQSPRNTEERMNGSHFKDEKAL
VTSQNSDLLDDEEVEDEVLLDEEDEDNDITGKTGKEPGTSNLHEGNHEDDYEDTSALEMS
CKTSPMRYKEEEYKTGLSALDHIRHFTDSLKMRKMEDNQYTEAEVSSFSASHVPEELKQP
LHRKSKSQAYAMMLSLSDKESLHSSPHNSSNVWHSMARAAAESSAIQSISHV
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgcctgctgagtttgaacttcgagagtcaaatatgcctggagcaggccttggaatatgg
accaaaaggaaaattgaagcaggtgaaaagtttgggccttatgtaggagaacagaggtca
aacctgaaagaccccagttatggatgggagatcttagatgagttttgcaatgtgaagttc
tgcatagatgctagtcaaccagatgtaggaagctggctcaagtacatcaggttcgctggc
tgttatgatcagcacaacctcgttgcatgccagataaatgatcagatattttatagagta
gttgcagacatcgcgccaggagaggagctcttgctgctcatgaagagtgaagactatccc
catgacaccatggcaccggatatccacgaagaacggcagtaccgctgtgaggattgtgac
cagctcttcgagtccaaggctgaactagcggatcaccagaagttcccgtgcagcacaccc
cacacggcattctccatggtagaggaggactttcaacaaaaactcgacagtgaaaatgat
ctccgagagatacatgcaattcaggagtgtaaggaatgtgaccaagtgtttcccgatttg
caaagcctggagaaacacatgttgtcacatactgaagagagggaatacaagtgtgatcag
tgtcccaaggcatttaactggaagtccaatttaatccgccaccagatgtcacatgacagt
ggaaagcactatgaatgtgagaactgtgccaagcaggtgttcacggaccctagcaacctt
cagcggcacatccgctctcagcatgttggtgcccgggcccacgcgtgcccagagtgtggc
aaaacgtttgccacttcgtcgggcctcaaacaacacaagcacatccacagcagtgtgaag
ccctttatctcattctctcaatcaatgtacccatttcctgatagagacttgagatcgtta
cctttgaaaatggaaccccagtcaccaagtgaagtaaagaaactgcagaagggcagctct
gagtctccctttgatctcaccactaaacgcaaggacgagaagcccttgaccccagtaccc
gccaagcctccagtgacgccggccacaagccaagaccagcccctggatctaagtatgggc
agtaggagtagagccagtgggaccaagctgacagagcctcgtaaaaaccacgtgtttggg
gaaaagaaaggaggcaacggtgaaccaagaccagcatctgatggttccttacagcatgct
agacccactcctttcttcatggaccctatttacagagtagagaaaagaaaactaactgac
ccacttgaagctttaaaagagaaatacttgagaccttctccaggattcttatttcacccg
caaatgtcagctattgaaaacatggcggagaagctggagagcttcagtgccctgaaacct
gaggccagtgaacttctacagtcggttccctccatgttcaacttcagagctcctcccaac
gccctgccagagaacctcctgcggaaaggaaaggaacgctatacctgcagatactgtggc
aagatttttccaagatctgcgaacctaacacggcacttgagaacccacacaggagagcag
ccttacagatgcaagtactgtgacaggtcattcagcatatcttctaacctgcagcggcat
gttcgcaacatccacaataaggagaagccctttaagtgtcacttatgtgataggtgtttt
ggtcaacaaaccaacttagacagacacctaaagaagcacgagaatgggaacatgtctggt
acggccacatcgtcgcctcattctgaactggaaagtacaggtgcgattctcgatgacaag
gaagatgcttacttcacagaaatacgaaatttcatcgggaatagcaaccatagcagccag
tctcccaggaacacagaagagagaatgaatggcagtcactttaaagatgaaaaggctttg
gtgaccagtcaaaattcagacttactggatgatgaagaggtggaagacgaggtgttgtta
gatgaggaggacgaagacaatgatattactgggaaaacaggaaaggaaccagggacaagt
aatttacatgaaggaaaccatgaggatgactatgaagacaccagcgccctggagatgagt
tgcaagacgtccccaatgaggtataaagaggaagaatataaaactggactttctgctcta
gatcatataaggcacttcacagatagcctcaaaatgaggaaaatggaagataatcaatat
actgaagctgaggtgtcttctttcagtgcttcccatgtgccagaggaacttaaacagccg
ttacacagaaagtccaaatcacaggcatatgctatgatgttgtcattgtccgacaaggag
tccctccattcttcaccccacaattcttccaacgtgtggcacagtatggccagggctgcg
gcggaatccagtgctatccagtccataagccacgtatga

DBGET integrated database retrieval system