KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008240
Entry
103008240         CDS       T03086                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103008240 (ANKRD53)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    103008240 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_3 Ank_4
Other DBs
NCBI-GeneID: 103008240
NCBI-ProteinID: XP_007175621
UniProt: A0A383ZKI7
Position
Un
AA seq 458 aa
MARPPERPSCTSVSLAEVWDQRAIGRYHELFAASLGNLEWLRFCLNRHRGEIPADDKGFT
AIHFAAQSGRLACLQVLVEEYKFPADLPTNDGQTPLHLVMHSDNKTMALPCIHYLIKQGA
ALNTQTCNGSTPLHLAAREGLLSCVKVLVQKGANVHAQDARGCKPIDYCKIWNHRICARF
LKDAMWQQDKKDFAHEMAKLKRLKKQLALTEEDCLTEYQKEQQILREADFKKWLHRKLLP
QGQSLIRNTQGAPRPPPQATVLSKTPKHRAPGPPKSVYPSREARLRQTLQPSQPSVMPIP
TCKQPMVRRPKVWNLSNNPVRSPTAQIGYPQGIRLGVHPDPRPEHDFRCFLEVRSDGHGG
ALLRTVAGHQVAPVPRLPLEVIIRELYPSVQPCRMKVPQGFCSVTMREVPRKRRLGDGAF
WTDTLSMNLRETFDEGFLAAVRAHQGLPALPSPKPPHT
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggcccggcctccagaaaggccttcgtgcacctccgtgagtctagccgaggtgtgggac
cagagggcaatcgggcgctaccacgagctgttcgcggcctcgctgggcaacctggaatgg
ttgcggttctgtctaaatcggcaccgtggggaaatcccggccgatgacaagggtttcact
gccatccactttgcagcccagagcggcaggcttgcatgcctgcaggtcttggtagaggag
tacaagtttcccgcggacctgcccaccaacgatggccagacacctctacaccttgtcatg
cacagtgacaacaagaccatggccctcccctgcattcactatctgattaagcaaggggcg
gccctcaacactcagacgtgcaacggctccacacccctgcacctggcagcccgcgagggc
ctgctgagctgtgtgaaggtcctggtgcagaaaggtgccaatgttcatgcccaagatgcc
aggggctgcaagcccatcgactactgcaaaatatggaatcaccgcatctgtgcccggttc
ttgaaggatgccatgtggcagcaggacaagaaggactttgcccatgagatggcgaaactg
aagaggctcaagaagcagctggcgctcacggaggaggactgcctgactgagtatcagaaa
gagcagcaaattctgagagaagctgacttcaagaagtggctacatcgcaagctgctgccc
caaggccaatccctgatccgcaacactcagggagcgccccgtcctccaccccaggccact
gtgctctccaagacccccaagcaccgggcaccggggcctcccaagagcgtctacccctcc
cgagaggcgcgcctgcgacagacgctgcagcccagtcagccctccgtgatgcctataccc
acctgcaagcagcccatggtcaggcggcccaaggtgtggaatctcagcaacaaccctgtc
aggtcccccaccgcccagatcggctacccgcagggcatccgcctgggcgtgcatcccgac
cccaggccggagcacgacttccgctgcttcctcgaggtgaggtctgacgggcacggtggt
gcgctcctgcgcacggtggccggccaccaggtggcgcctgtgccccggctgcctttagag
gtgataatccgcgagctgtacccgtcggtgcagccgtgcaggatgaaggtgccccagggc
ttctgttctgtcaccatgagagaggtgccccggaagcggcgcctgggtgatggcgccttc
tggaccgacactctgagcatgaacctgcgagagacatttgacgaaggcttcctggcagct
gtgcgagcccatcaagggctccccgctctgccctcccccaaaccaccccacacttaa

DBGET integrated database retrieval system