KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008271Help
Entry
103008271         CDS       T03086                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00220  Arginine biosynthesis
bacu00330  Arginine and proline metabolism
bacu01100  Metabolic pathways
bacu01230  Biosynthesis of amino acids
bacu05146  Amoebiasis
Module
bacu_M00029  Urea cycle
bacu_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103008271 (ARG2)
   00330 Arginine and proline metabolism
    103008271 (ARG2)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103008271 (ARG2)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     103008271 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 103008271
NCBI-ProteinID: XP_007184400
UniProt: A0A384AAN8
Position
Un
AA seq 354 aa AA seqDB search
MSLRSSLSLLLRTQARSVPKKSVHSVAVIGAPFSQGQKRKGVEYGPTAVREAGLMKRLSD
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSGGYSCVTVGGDH
SLAIGTISGHARHCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLKELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYITEEIHNTGLLSALDLVEVNPR
LAASEEEAEATASLAVDVIASSFGQTREGGHIVYDQLPTPSSPDVSESEERVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgaggagcagcctctcgcttcttctccgtacgcaagcgcgctcagtccctaag
aagtccgtccactccgtggctgtcattggagccccattttcacagggacagaaaagaaaa
ggagtggaatatggtcccactgctgtaagagaagctggcttgatgaaaaggctctccgat
ttgggctgccaccttaaagacttcggagacttgagttttactccagttcccaaagatgat
ctctataataacctgatagtgaatcctcgctcagtgggccttgccaaccaggaattagcg
gaggtggttagtagagcagtgtcaggtggctacagctgtgtcaccgtgggaggagaccac
agcctggcaatcggtaccattagtgggcacgcccggcactgcccagacctttgtgtgatc
tgggttgatgcccatgctgacatcaatacacccctcaccacttcatctggaaatctccat
ggacagccagtttcatttctcctcaaagaactacaggacaaggtcccacaactcccagga
ttttcctggatcaaaccttgtatctcttccccaagtattgtatacattggactaagagat
gtggaccctcctgaacattttattttaaagaattatgatatccagtacttttccatgaga
gacatagatcgacttggtatccagaaggtcatggaacagacatttgatctgctgattggc
aaaagacaaaggccaatccatctgagtttcgatattgatgcatttgaccctacgctggct
ccagccacaggaacccctgttgtagggggactgacctatcgagaaggcatgtatattact
gaggaaatacacaatacagggttgctctcagcactggatcttgtggaagtcaatcctcgg
ttggctgcgtcagaggaagaggccgaggctacagccagcctggcagtggatgtgattgct
tcaagttttgggcagacaagggagggagggcacattgtctatgaccaacttcctactccc
agttcaccagatgtatcggaaagtgaagaacgtgtaagaatttag

DBGET integrated database retrieval system