KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010585Help
Entry
103010585         CDS       T03086                                 

Gene name
WNK2
Definition
(RefSeq) WNK lysine deficient protein kinase 2
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103010585 (WNK2)
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103010585 (WNK2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103010585 (WNK2)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: Other
  Wnk family
   103010585 (WNK2)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103010585 (WNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103010585
NCBI-ProteinID: XP_007182081
UniProt: A0A384A401
Position
Un
AA seq 1991 aa AA seqDB search
MLKGLQHPNIVRFYDFWESSARGKRCIVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQ
ILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFM
APEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDP
EIKEIIGECICKKKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPK
KLKGKPKDNGAIEFTFDLERETPDDVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRK
RIWPALQPQEQRDPGSPDKARGPPTPLQVQVTYHSQAGPPELEEPEADQHLLTPALPASA
TSLASDSTFDSGQGSTVYSDSQSSQQSVVLGSLADGVQPPAQCVCSPPVSVSDGPVLPHS
LPSLGAYQQPAVPGLSVASIPPPARPLLPQQPFPEPAMSFAPGLPPPSAPVPTGPGQPTP
PAHQPPHLTQPVPLPQVLAPQPVGPLQPVPPNLPPYLAPASQVVAPAQLKPLQMPPAPLQ
PLAQVPPQMPPLPVVPPITPLATVDSLPAALPDLPATSGPAVPPPSQYFSPGVILPSLPL
SATTAPLPTSPALPLQTVKLPHPPGAPLAVPCRTIVPNVAATATGVPLLAVAPQGVAALS
THPTVAQPPAQPVYPAAFPQLVPSDVPPSPLHAAQTVRAAPPHPAPPVLPQPHKPSVARL
AEQAAPAASAGSQILLGHPPPYAVDVTTQVPTVPTPAAVLSPPLPEVLPPTAPELLPQLP
GSLAPTLMAAAQSLPVQTTALLPPANLPLPSGPGITGPCPAVQLTVELAPEEQALQDKQP
SLPQSCESYGGSDVTSGREMSDSCEGAFGGGKLEGKAARKHHRRSTRARSRQERASRPRL
TILNVCNTGDKMVECQLETHNHKMVTFKFDLDGDAPDEIATYMVEHDFILQAERETFIEQ
MKDVMDKAEDMLSEDTDVDRGSDPGVSPPHLSTCGLGSGEESRQPQANAPVYQQNVLHTG
KRWFIICPVAEHPAAEAPESSPPLPLSSLQPDTSQDPVFCKGQLSLKEKPSFSASLQLLS
QAGLRDPPGGAPSPLVPSTPPVTAVPQDVAPPAASPKPEPATGAAMQAGVPGTPQGLASE
HKTPWLLVETHDAQLAAQALGTGQGPCAPSLEAPSHSMGLGDPGSAREPSTRGEPLLALA
PVSGAPGGAPQPTLGQPLPPLPSVVGSISLATPQLPSPPLAPTAPPQPPSALESDGEGPP
PRVGFVDSTIKSLDEKLRTLLYQEHVPTSSALAGTPVEAGDRDFIPEPPRGDEPRTEAAG
GDLALLPQPALEKSETALGLDVTLEQATSLPVTESSLSSMLGCEGGQVASDSPVVPSVPQ
DAPASAIPAHLEPTDWTSRVPGETLAESTQSCPGTLTQRGQDSHPQTHSTLVSGSPQKWP
GQQDGSSPAKTVGRFSVVSTQDEWTLASPSSLRYSAPPDVYLDEAPRSPDMKLAVRRAQT
ASSIEVGMGEPMSSDSGDECPRRRPPMQKHTSLPGSGGGVASDFVKKATAFLHRSSRAGS
PGLETPSRMGVKVPTISVTSFHSQSSYISSDNDSEIEDADIRKELQSLREKHLKEISELQ
SQQKQEIEALYRRLGKALPPNLGLFHTAPPVGRRRKTSKSKLKAGKLLNPLVQQLKVVAS
STGHLSDCSRAPPAKDPAQAGAGPTAASDPCGKAVQTQQPCSVRASLTADICSGLASDGG
GAHGPGWTVYHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRSSTSSL
VPGPEPGPQPALHIQAQVNNSNNKKGTFTDDLHKLVDEWTSKTVGPTQLKPSLNQLKQTQ
KLHDMEAMAGWRPASGEARAMNTSRTAVGMPCLTPAPSPLPTAVIPGAASAQPVPMPGTA
LSCLPAPPYALPLGQYGSLIPAPVSWGPWAAQAGSWSLDEGPGLGATGTPALPMFLWPPM
VSMPGPRLRIT
NT seq 5976 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagggcctgcagcaccccaacattgtgcgcttctatgacttctgggagtccagt
gccagggggaagcggtgcatcgtgctggtgactgaactgatgacctcggggacgctgaag
acgtacctgaagcggttcaaggtgatgaagcccaaggtcctgcgcagctggtgccggcag
atcctgaagggcctgctgttcctgcacaccaggacgccccccatcatccatcgggacctc
aagtgcgacaacatctttatcaccggacccacagggtctgtgaagattggcgacttgggc
ctggccaccctcaagagagcatcctttgccaagagtgtgataggtacccctgagttcatg
gcgccagagatgtatgaggagcattacgatgagtccgtggatgtttatgccttcgggatg
tgtatgctggagatggccacctcggagtacccctactcggagtgccagaacgccgcccag
atctacaggaaggtcacctgtggcatcaagccggccagctttgagaaagtgcatgatcct
gaaatcaaggagattattggggagtgtatctgcaaaaaaaaggaggaaaggtacgagatc
aaggacctgctcagccacgccttcttcgcggaggacacaggtgtgagggtggagctggct
gaggaggaccatggcaggaagtccaccatcgccctgcggctctgggttgaggaccccaag
aaactgaagggcaagcccaaggacaatggggccatagaattcacctttgacctggagagg
gagacgccggatgacgtggcacaggaaatgattgagtcaggatttttccatgagagcgat
gtgaagattgtggccaagtccatccgtgaccgcgtggcattgatccagtggcggcggaag
aggatctggccagcgctgcagccccaggagcagcgggaccctggcagccctgacaaggcc
aggggcccacccacacccctgcaggtccaggtgacctaccactctcaggctgggccgcca
gagctggaggagcccgaggccgaccagcacctcctcacccctgcgctgccggccagcgcc
acctccctggcctcggacagcacgtttgacagtggccagggctccacggtgtattcggac
tcgcagagcagccagcagagcgttgtgctgggctcgctggcagatggagtgcagcccccc
gcccagtgtgtgtgcagcccccccgtgagcgtgagtgacgggcctgtcctgccacatagc
ctgccctcactgggggcctaccagcagcctgccgtgcctggcctgtcggtggcctccatc
ccgccccccgcccgccctctgctcccacagcagcctttcccagagccggccatgagcttc
gcccctgggctgccgccgcccagtgcccctgtgccgacgggcccaggccagcccacaccc
cccgcccaccagcctcctcacctgacccagccggtacccctgccacaggtcctggcccca
cagcctgtgggccctctccagccggtgccccccaacctacctccatacctggctccagcc
tcccaggtggtggcccctgctcagctgaagcccctccagatgcctccggcgcccctgcag
ccacttgctcaagtccctccgcagatgcctccacttcctgttgtcccccccatcactcca
ctggccacagtcgacagcctccctgcagcccttcctgacctgccagccaccagtgggccc
gccgtgcctcccccctctcagtatttctctccgggtgtcatcttgccaagcctcccactc
agtgccaccactgctcccctgcccacgtcaccggccctgcctctgcagacagtcaagctg
ccccaccctcctggggcaccactggccgtgccatgccggaccatcgtgccaaacgtggcg
gccactgctactggcgtccctctgctggctgtggccccgcagggcgtggctgccctgtcc
actcaccccaccgtggcccagccccctgcccagcccgtgtacccggcggcctttccgcag
ctggtgcccagcgacgtcccgccttctcccctccatgcagcgcagaccgtgcgggctgcg
cccccccacccggcacccccagttctgccacagccccacaagccgagtgttgcccgcctt
gccgagcaggctgctccggccgccagtgctgggagtcagatcctgcttggccacccgcct
ccatatgccgtggacgtcaccacccaggtccctacagtgcccacgcctgctgccgttctc
tccccacctctgccagaagtgctgccgcctactgcccccgagctcctgcctcagctcccc
ggctccctggcccccacattgatggcggctgctcagagcttgcctgtccagaccactgcg
ctcctgccacctgctaacctgccactgcccagcgggcctgggatcactggtccctgccca
gccgttcagctgacagtggagctggccccggaggagcaggccttgcaggacaagcagcca
agcctccctcagagctgtgagagctatggaggttccgacgtcacttctggaagagagatg
agtgacagctgtgaaggtgcatttggtggggggaagctggaaggcaaggccgctcggaaa
catcaccgcaggtccacgcgtgcacgctcccgccaggagagggccagccggccccggctg
accatcctgaatgtgtgcaacacgggtgacaagatggtggagtgccagctggagacacac
aaccacaagatggtgacgttcaagtttgacctggatggggatgcacctgacgagattgct
acctacatggtagagcacgacttcatcctgcaggctgagcgggagacattcattgagcag
atgaaggacgtcatggacaaggcagaggacatgctcagtgaggacacggatgtggaccgt
ggctctgaccctggggtgagcccgccgcacctcagcacctgtggcctgggctctggggag
gagagtcgccaaccccaagcgaatgccccggtgtatcagcaaaatgtccttcacactggg
aagaggtggtttatcatctgtccagtggctgagcatccagcagcagaggcccccgaatct
tcacccccacttcctctgagctccctgcagccagacaccagccaagatccagtgttctgt
aaaggccagctgtctttgaaggaaaaacccagcttctcggctagtctgcagcttttgagc
caagcaggcctcagggaccctcctggtggtgcaccgtcccctttggtgccatcaacccct
cccgtgactgctgtgccccaagacgtggccccaccagctgccagtcctaagccagagcca
gcaacaggggctgccatgcaggcaggggtcccagggacccctcaggggctggccagtgag
cataagaccccctggctactagtggagactcatgatgcccagcttgctgcacaggccctt
ggcacaggccaagggccttgtgccccatctctggaggccccatcccactccatgggtctg
ggggatcctggctcagccagagagcccagcaccaggggggagcccctgttggctttggct
cctgtgtctggtgcccctggcggggcccctcagcccaccctgggccagccccttcctcca
ctcccctctgtggtgggctccatcagcctggccactccccaacttcccagccccccactg
gcacctaccgccccccctcagccgccctcagccttggagtcagatggggaagggccaccc
ccaagggtgggcttcgtggacagcaccatcaagagcctggatgagaagctgcggactctg
ctctaccaggagcatgtgcccacctcctcagccttggccgggacccctgtggaggcaggt
gaccgagacttcatcccggagcccccaagaggggacgaaccccgcacagaggccgctggg
ggtgacctggccctgctgccccagcctgcgttggaaaagtcagaaacagcccttggatta
gatgtcacgttggagcaggccacgtccttgccagtgacagaatcgtctttgagcagcatg
ctgggctgtgagggaggacaggtggcctcagattcgcctgtagtacccagtgtcccccag
gatgcccctgcttctgccatccctgcacatctggagcccacagattggaccagcagggtc
cctggggaaaccttggccgagtccacgcagagctgcccggggacattgactcagcgtggc
caggacagccatccccagacacacagcactctggtctcgggatcccctcagaagtggcca
gggcagcaggatggcagctcgccagccaaaactgtgggccggttctcagtggtcagcacc
caggatgagtggactctggcctcccccagtagcctgcggtactcagccccacctgacgtg
tacctggacgaggccccccgcagcccagacatgaagctggctgtgcggcgggcacagacg
gcctcctccatcgaggtcggcatgggcgagcccatgtccagtgactctggggacgagtgc
cctcgaaggaggccccccatgcagaagcacacctccctgcctggcagcggtggtggtgtg
gccagtgactttgtgaagaaggccactgccttcctgcacaggtcctctcgggctggctcc
ccaggcctggagacacccagcaggatgggtgtgaaggtccccaccatcagcgtgacctcc
ttccactcccagtcatcctacatcagcagtgacaatgactcagagatcgaggatgctgat
atcagaaaggagttgcagagtcttcgagagaagcatctgaaggagatctcggagctacag
agtcagcagaagcaggagatcgaggccctgtaccgccgcctaggcaaggcgctgcccccc
aacctgggtctcttccacacggcacctccagtcggccgccggagaaagaccagcaagagc
aagctgaaggcggggaagttgctaaaccccctggtgcagcagctcaaggtcgtggcctcc
agcacaggtcacttgtcagactgcagcagagcccctcctgctaaggaccctgcccaagct
ggggcagggcccacagcagcttcagacccatgtgggaaggcagttcagacccagcagcct
tgctccgtgcgggcctccctgactgcagacatctgctccggcttggccagtgatggaggc
ggagcgcatggcccaggctggacggtttaccacccaacgtctgagagagtgacctataag
tctagtagcaaacctcgcgctcgattcctcagtggacccgtgtctgtgtccatctggtct
gccttgaagcgtctctgtctaggcaaagagcacagcagtcggtcctccaccagcagcctg
gtcccgggccctgagccgggcccccaacctgccctgcacatccaggcgcaggtgaacaac
agcaacaacaagaaaggcaccttcacggacgacctgcacaagttggtggacgagtggaca
agcaagacggttgggcccacacagctgaagccgtcactcaaccagttgaagcagacgcag
aagttgcatgacatggaggccatggcaggctggcgcccggcctctggcgaggcacgggct
atgaacacgtctcgaacggcagtggggatgccatgtctgaccccggcacccagccctcta
cccaccgcggtcattcctggagctgcctcagcccagcctgtgcccatgccaggtactgct
ctctcctgccttccagccccgccctatgcactgcctctgggccagtatggaagcctgatc
ccagctccagtgtcctgggggccctgggcagcccaagcaggcagctggagccttgatgag
gggccaggcttgggtgcaacaggcacgccagcactccccatgttcttgtggccacctatg
gtcagcatgcccggccccaggctgcggatcacatag

DBGET integrated database retrieval system