KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010865Help
Entry
103010865         CDS       T03086                                 

Gene name
AMHR2
Definition
(RefSeq) anti-Mullerian hormone receptor type 2
  KO
K04672  anti-mullerian hormone receptor type-2 [EC:2.7.11.30]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103010865 (AMHR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103010865 (AMHR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103010865 (AMHR2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103010865 (AMHR2)
Protein kinases [BR:bacu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103010865 (AMHR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103010865
NCBI-ProteinID: XP_007179504
UniProt: A0A383ZX53
Position
Un
AA seq 549 aa AA seqDB search
MLGILGLWALLPTAVQAPPGRRTCVFFEAPGVRGSTKNLGKLLDAGPGPPRVIRCLYSRC
CFGIWNLTQDQAQVEMQGCRDSDEPGCESPHCDPSPRAHPSPSFTLFTCSCGTDFCNANY
SHLSRLGSPGTPGSQGPKAIPGSXXXXXXXXLGLLLLLLLLSNIILALLQRKGCRAHGGP
EPGPGPEPEPEPHSGRDWSAELPELPELCFSQVIREGGHAVVWAGRLQGKLVAIKAFPLR
AVAQFQAERALYGLPGLRHDHIVRLITASRGSPGPLPCGPLLVLELHPKGSLCHYLAQHT
SDWGSSLRMALSLAQGLAFLHEERWQDGQYKPGIAHRDLSSQNVLIRDDGSCAIGDLGLA
LVLPGLAQPPTWAPTQPRGPAAIMEAGTQRYMAPELLDKTLDLQDWGTALRRADVYSLAL
LLWEIMSRCPDLRPDSRPPPFQLAYEAELGSTPTTCELWNLAVEERRRPHIPSTWGCFAT
DPGGLRELLEDCWDADPEARLTAECVQQRLASLARPQEAHPLPQGCPHGCPPLCPEDRLS
TPPPCHSPS
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgctggggattctggggctttgggcactgcttcccacagctgtgcaagcacccccaggc
aggcggacctgtgtgttctttgaggcccctggagtgcggggaagcaccaagaatctgggg
aagctgctagatgcaggaccagggccccccagggttatccgctgcctctacagccgctgc
tgctttgggatctggaacctgacccaagaccaggcacaggtggagatgcaaggatgccga
gacagtgatgagccaggctgtgagtccccccactgtgacccgagcccccgagcccatcct
agtcccagctttactctcttcacctgctcctgtggcactgacttctgcaatgccaattac
agccatctgtctcgtctggggagccctgggacaccgggttcccagggccccaaggccatc
ccaggtagcnnnnnnnnnnnnnnnnnnnnnnngctggggctgctcctcctcctgctgctg
ctgagcaacatcatcttggccctgctacaacggaaaggctgccgggcgcatggtgggcca
gagccagggccggggccggagccggagccggaaccacactcaggcagggactggagtgcc
gagctgcccgagctgcccgagctgtgcttctcccaggtaatccgggaaggaggtcacgca
gtggtgtgggccgggcggctgcaaggcaagctggttgccatcaaggccttccccctgagg
gctgtggcccagttccaagctgagagagcattgtacgggctgccgggcctacggcatgac
cacattgtccgcttgatcaccgccagcaggggcagccctggtcccctgccctgtgggccc
ctgctggtactggaactacaccccaagggctccctgtgccactacttggcccagcacacc
agtgactggggaagttccctgcggatggcactgtccctggcacagggcctggcgtttctc
catgaggaacgttggcaggatggccaatataaaccaggtatcgcccaccgggatctgagc
agccagaatgtgctcattcgggacgatgggtcatgcgccattggagacctgggcctcgcc
ttggtgctccctggcctcgcccagcccccaacctgggctcctactcaaccccgaggccca
gctgccatcatggaggcgggcacccagaggtacatggcaccggagctcttggacaagact
ctggacctacaggactggggcacggccctccggcgagctgatgtttactctctggctctg
ctcctgtgggagatcatgagccgctgcccagatttgcgacccgacagcagaccaccaccc
ttccaactggcctatgaggcagaactgggtagcacccctaccacctgtgagctgtggaac
ttggcggtggaggagagaaggcgccctcacatcccatccacctggggctgctttgccaca
gaccctggtggcctgagagagctcctggaggactgctgggatgcagacccagaagcacgg
ctgacagctgaatgtgtacagcaacgcctggcttccctggcccgtcctcaggaggcccac
cccctcccacagggctgtccacatggctgcccacctctctgcccagaagaccgtctctcc
actcctccgccctgccattctccctcgtag

DBGET integrated database retrieval system