KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012113
Entry
103012113         CDS       T03086                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bacu01002]
    103012113 (ERAP1)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     103012113 (ERAP1)
Peptidases and inhibitors [BR:bacu01002]
 Metallo peptidases
  Family M1
   103012113 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 103012113
NCBI-ProteinID: XP_007197532
UniProt: A0A384BDK2
Position
Un
AA seq 942 aa
MISLSIKRPLVTMSFLLSSLLMLLTVATPSWCQSSETTSPKANNRAPFPWNKMRLPEHIT
PVHYDLVIHANLTTLTFGGTTEIEITASKPTSTIILHSHHLQISKAALRKGAGERQSEEP
LRVLEYPPQEQIAFLAPEPLVVGLPYTIVIDYAGNLSESFHGFYKSTYRTKEGEVRILAS
TQFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVT
VKMSTYLVAFIVSDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSI
PYPLSKQDLAAIPDFQSGAMENWGLTTYRESSLLFDAEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFNAMEVDALNSSHPV
STPVENPAQIREIFDEVSYEKGACILNMLRDYLGADAFKSGIVKYLQKYSYKNTKNEDLW
NSMASICPTDGTQQMDGFCSRGEHSSSSSHWRQEGLDVKTMMNTWTLQKGFPLITITVRG
RNVHVKQEHYVIGPDDAPETGYLWHVPLTFITSNSDSVQRFLLKTRTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAISSSDRASLINNAFQLVSIGKLFFEKALD
LSLYLKHETEIMPVFQGLNELIPMYKLMEKRDVNEVETQFKAFLIGLLRDLIDKQTWTDE
GSTSERMLRSQLLLLACVRKYQPCVQKAEGYFRRWQEANGNLSLPSDVTLAVFAVGAQNP
EGWDFLYSKYQSSLSSTEKNQIEFALCITHNKEKLQWLLEQSFKGDTIKTQEFPDILRAI
GRNPVGYPLAWQFLRENWNKLVQKFELGSNSIAYMVMGTTNQFSTRARLEEVKEFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQNEKLELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatatctctgtccatcaaacggccccttgtcaccatgtcctttctgctttcatcactg
ttgatgctcttaactgtggcaactccatcctggtgtcagagcagtgaaacgacatctcca
aaggctaataacagggcaccatttccttggaataaaatgcgacttcctgagcacatcacc
ccagttcattacgatctcgtgattcatgccaacctcaccactctgactttcgggggaacc
acagaaatagaaatcacagccagcaagcccaccagtaccatcatcctgcatagtcaccac
ctgcaaatatctaaggccgccctgaggaagggagctggtgagaggcagtctgaagagccg
ctgagagtcctggaatacccgcctcaagagcaaattgcattcctggctcctgagcccctg
gtagttgggctcccatacaccattgtcattgactatgctggcaatctttctgagagtttc
catggattttataaaagcacctacagaaccaaggaaggggaagtgaggatacttgcatca
acacagtttgaaccgactgcagccagaatggcctttccctgctttgatgaacctgctttc
aaagcgagtttttcaatcaagatcagaagggaaccaagacacctcgccatctccaacatg
ccactggttaaatctgtgactgttgctgaaggactcatagaagaccattttgacgtgact
gtgaagatgagcacctacctggtggccttcattgtttcagattttaagtctgtcagcaag
atgaccaaaagtggcgtcaaggtttccgtatatgctgttccagacaagataaatcaggca
gattatgcactggatgccgcggtgactcttctagaattttatgaggattatttcagcatt
ccatatcccttatccaaacaagatcttgctgctattcctgactttcagtctggtgctatg
gaaaactggggactgacaacatacagggaatcttctctactgtttgatgctgaaaagtct
tctgcatcaagtaagcttggcatcacgatgactgtgtcccatgaactcgcccaccagtgg
tttgggaacctcgtcactatggaatggtggaatgatctttggctaaatgagggatttgcc
aagtttatggagttcgtgtctgtcagtgtgactcatccagaactgaaagttgaagattat
ttctttggtaagtgttttaatgctatggaggtagatgcattaaactcctcacaccctgtg
tccacacctgtggagaatcctgctcagattcgggagatatttgatgaagtttcttatgaa
aagggagcctgtattctgaatatgctaagggattatcttggtgccgatgcatttaaaagt
ggtattgtaaagtatctgcagaagtatagctataaaaacacaaaaaacgaggacctttgg
aatagtatggcaagtatttgccctacagatggcacacaacaaatggatggattttgttct
agaggtgaacattcatcttcatcttcgcactggcgacaggaaggccttgatgtgaaaacc
atgatgaacacctggacgcttcagaagggctttcccctgataaccatcacagtgagaggg
aggaacgtacacgtgaagcaagagcactacgtgataggcccggacgacgccccagaaact
gggtacctgtggcatgtcccattgacattcattaccagcaactcagactcagtccagcga
tttttgctgaagacaagaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgttggaatgaatggctattacatcgtgcattatgaggatgatggatgggattct
ttgactggccttttaaaaggaacacacacggcaatcagcagtagtgatcgggccagtctc
attaacaatgcatttcagcttgtcagcattggaaagctgttctttgaaaaagccttggat
ttaagcttgtacttgaaacatgaaactgaaatcatgccagtgttccaaggtttgaatgaa
ctgatacctatgtataagttaatggagaaaagagatgtgaatgaagtggaaactcagttc
aaggcctttctcatcgggctgctgagggacctcattgataagcagacttggacggatgag
ggctccacctcagagcgaatgttgcggagtcagctgctcctgctggcctgtgtgcgcaag
taccagccctgtgtgcagaaggcagaaggctatttcagacggtggcaggaagccaatggg
aatttgagcctgcccagcgatgtgaccttggcagtgtttgctgtaggggcccagaaccca
gaaggatgggattttctttatagtaaatatcaatcgtcattgtccagtactgagaaaaac
caaattgaatttgctctctgtattacccacaataaagaaaagcttcagtggctactagaa
caaagttttaagggagatacaataaaaactcaagagtttccagatattcttagagctatc
ggcagaaacccagtgggatatccattggcctggcagtttctgagggaaaattggaataaa
cttgtacaaaagtttgaacttggctcaaattccatagcctacatggtaatgggaacaaca
aatcaattctcgacaagagcacggcttgaagaggtaaaagaattcttcagctctttgaag
gaaaatgggtctcagctccgttgtgtccaacaaacaattgaaaccattgaggaaaacata
cgttggatggataagaattttgataaaatcagagtgtggctacaaaatgaaaagcttgag
ctgctgtaa

DBGET integrated database retrieval system