KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013640
Entry
103013640         CDS       T03086                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103013640 (RDH5)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     103013640 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 103013640
NCBI-ProteinID: XP_007179868
UniProt: A0A383ZXL7
Position
Un
AA seq 321 aa
MWLPLLLGVSLWAALWLLRDRQSLPASDAFVFVTGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLERVASSRLHTTLLDVTDPQSVRQAAKWVETHVGEAGLFGLVNNAGTAGIIGP
TPWQTQEDFQRVLNVNTLGPIGVTLALLPLLRQAQGRVINITSVLGRLAASGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTPVTNLESLEDNLQACWARLTPATQALYGET
FLTKYLRVQQRIMNLICDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVEAVLTCVLPKPAQPAQAVW
NT seq 966 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgcttctgggcgtctcgctctgggcagcactgtggttgctcagggac
cggcagagcctgcccgccagcgatgctttcgtctttgtcaccggctgtgactcgggcttt
gggcggcttctggcactgaggctggaccagagaggcttccgagtcctggccagctgcctg
accccctcaggggcagaggacctcgagcgggtggcctcctcccgactccacaccaccctg
ctggatgtcacagatccccagagcgtccggcaggcagccaagtgggtggaaacacacgtc
ggggaagcagggctttttggtctggtgaataatgctggcacggctggcatcatcgggccc
acaccttggcagacacaggaggatttccagcgggtgctgaatgtgaacacactgggtccc
atcggggtcaccctcgccctgctgcccctgctgcggcaggcccagggccgggtgatcaac
atcaccagtgtcctgggccgcctggcagccagtggagggggctactgtgtctccaagttt
ggcctggaggcgttctctgacagcctgaggcgggacgtggctcctttcggggtacgagtc
tctatcgtggaacctggcttcttcagaacccctgtgacaaacctggaaagtctggaggac
aacctgcaggcctgctgggcacggctgactccagccacacaggccctctatggggagacc
ttcctcaccaagtatctgagagtgcagcaacgcatcatgaacctgatctgtgacccggac
ctgaccaaggtgagcaggtgcctggagcatgccctgactgcccgtcaccccagaacccgc
tacagcccaggctgggacgccaagctgctctggctgccagcctcctacctgccagccagc
ctggtggaggctgtgctcacctgtgtccttcccaagcctgctcagcctgctcaggcggtc
tggtga

DBGET integrated database retrieval system