KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013726Help
Entry
103013726         CDS       T03086                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00561  Glycerolipid metabolism
bacu01100  Metabolic pathways
bacu04714  Thermogenesis
bacu04723  Retrograde endocannabinoid signaling
bacu04923  Regulation of lipolysis in adipocytes
Module
bacu_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    103013726 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    103013726 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    103013726 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    103013726 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bacu01002]
    103013726 (MGLL)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103013726 (MGLL)
Peptidases [BR:bacu01002]
 Serine Peptidases
  Family S33
   103013726 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_5 Peptidase_S9 Abhydrolase_3 LIDHydrolase Abhydrolase_2 Thioesterase PGAP1 BAAT_C DUF1057
Motif
Other DBs
NCBI-GeneID: 103013726
NCBI-ProteinID: XP_007179253
Position
Un
AA seq 313 aa AA seqDB search
METGPEDPFRMPEESSPRRTPQSVPYQDLPHLVNADGQYLFCRYWKPSGTPRALVFVSHG
AGEHCGRYDELARMLVGLELLVFAHDHVGHGQSEGERMVVSDFQVFIRDVLQHVDVVQKD
HPGLPIFLLGHSMGGAITILTAAERPGHFSGMVLISPLVLANPESATTFKVLAAKVLNLV
LPNVSLGRIDSSTLSRNKTEVAIYNTDPLICRAGLKVCFGIQLLNAVSRVERALPRLTLP
FLLLQGSADRLCDSRGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTSSVFREINTWV
SQRTAAAGTGSPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacctgaagatcctttcagaatgccggaggaaagttctcccaggcggacc
ccgcagagtgttccgtaccaggacctccctcacctggtcaacgccgacggacagtacctc
ttctgccggtactggaaaccctcgggcacacccagggccctggtctttgtgtcccacgga
gcgggggagcactgcggccgctacgacgagctggctcggatgctggtggggctggagctg
ctggtgtttgcccacgaccacgtcggccacgggcagagcgagggggagaggatggtggtg
tctgacttccaggttttcatcagggacgtgttgcagcacgtggacgttgtgcagaaggac
cacccggggcttcccatcttcctcctgggccactccatgggaggcgccatcaccatcctc
acggccgcagagaggcccggccacttctccggcatggttctgatctccccgctggttctc
gccaatcccgagtctgccacgactttcaaggtccttgctgcgaaagttctcaaccttgtc
ctgccgaacgtgtccctgggccggatcgacagcagcacgctctcacggaataagacagag
gtggccatctacaacacggaccccctcatctgccgggcggggctgaaggtgtgcttcggc
atccagctgctcaacgccgtctcgagggtggagcgggcgctgcccaggctgaccttgccc
ttcctgctgctgcagggctctgccgaccgcctgtgtgacagcaggggcgcctacctgctc
atggagtccgccaagagccaggacaagacgctcaagatttacgaaggtgcctaccacgtc
ctccacaaagagcttcccgaagtgaccagctccgtcttccgtgagataaacacgtgggtc
tctcaaaggacagcggcggcaggaacggggtccccgccctga

DBGET integrated database retrieval system