KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013811
Entry
103013811         CDS       T03086                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bacu03021]
    103013811 (AFF3)
Transcription machinery [BR:bacu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     103013811 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 103013811
NCBI-ProteinID: XP_007197471
UniProt: A0A384BCQ1
Position
Un
AA seq 1260 aa
MLSGSGRAEKPEERQSRSLASCARFPLPSSGEGGRSSSSVIPVSADGVEGTAWHRHRGGP
MRGGQGEDILNQRSDSLVVEFQSSASRCRRYYIGVYEPDRNVLRRKERERRNQETQQDDG
AFNSSYSLFSEPYKTNKGDELSNRLQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQAP
VNKIDEHFVADSRAQTQPASVCSTTSSTPAVVPGQQSKRGTVGWQKAGHPPSDGQQRATQ
QGSLRTLLGDGVGRQQPRTKQVCNVEVGLQTQDRPPAMGAKHSGSGHCVQNFPPSLASKP
SLVQQKPTAYVRPMDGQDQAPDESPKLKSSTETSVHCASYRGASGTKPESARAKAKLSKF
SIPKQGEESRSGETNSCVEEIIREMTWLPPLSAIPAPGKVEPSKFPFPNKDSQLTSSGHS
NPKKGDAETGSPDNGTSTTSMLEDDLKLSSDEEENEQQAAQRTALHALSDSAGLPQANCR
PSVPSSKGSSSGSSSSGSSSSSDSESSSGSDSESESSSSESEGSKPPHYSSPEAEPASSN
KWQLDKWLNKVNPHKPPILIQNESHGPESNQYYTPVKDEAPDCGKLPDNVCPTSLRDKDI
KSACKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVTTANAPPPTEPAGADALGASVGIPP
EPPKPRPCGNSRTSHRKELRSAVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLE
SEQEDFPLSKATAASGSDPRLKEAANSISGGGPRAPVGSINARTTSDIAKELEEQFYTLV
PFGRNELLSPLKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGVLSAPAAKDTESAPPSHAS
DAPAEKALPKSKRKRKCDNEEDYREIKKAQGEKESSSRLTASANSTLSANHCNVNVNSLA
IPINKNEKMLRSPTSPLSDASKHKYSGEDLTSPSRSNSNGLFTSASSNKKHKAENQLQTH
GGDLTKAAHNNSENNVLHKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADYFMQEAKR
MKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLK
THSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSP
WGASGKSTGTPSPMSPNPSPTSSVGSQGSLSNGNALSPSTIVSIPQRIHQMAANHVSITN
SILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLYWLRNSTHLT
NT seq 3783 nt   +upstreamnt  +downstreamnt
atgctcagtggaagcggcagagctgagaaacccgaggaaaggcagtcaagaagtcttgcc
tcttgtgcaaggtttcctttgccctcctctggagaagggggacggtcgtcatcttcggtc
attccggtttcagctgatggtgtggagggcacggcctggcacaggcatcgtggcggtccc
atgagaggtggccagggtgaagacatcttaaaccagaggagtgactctctagttgtggaa
tttcagtcgtcagccagcagatgcaggaggtattatattggtgtctatgaaccagataga
aacgtgttacggaggaaagaacgagaaagaagaaatcaggaaactcagcaggatgatggc
gcgtttaattcaagttactccctctttagtgaaccctacaagactaacaagggggatgag
ctctccaaccggctccagaacactttaggcaattacgatgaaatgaaagactttttaacg
gatagatcgaatcagagtcatctcgttggcgttcccaaacctggggttcctcaggctccc
gtgaacaagattgacgagcattttgttgcagattcgagagcccagacccagcctgcatcc
gtctgcagcaccacgtcctccaccccagcagtggtccctgggcagcagagtaagaggggc
accgtgggctggcagaaggccgggcacccaccgtccgatggccaacagagagcaacacaa
cagggctctctcaggaccttgcttggagatggtgttggcagacagcagccgcggaccaaa
caggtgtgcaacgtcgaggtgggtcttcagacccaggacaggccacctgctatgggagcc
aagcacagcggcagtggccactgtgttcagaactttcctccatccctggcttcaaaacct
agcctcgtccagcagaaaccgactgcctatgtacgaccgatggatggccaagatcaggct
cccgatgagtctccgaagctgaagtcgtccacagagaccagcgtgcactgtgcgtcatac
aggggagcctcgggcaccaagccagagtccgccagagccaaggccaagctttccaagttc
agcatccccaaacaaggagaggagagtagatctggagaaaccaacagctgtgttgaagaa
ataattcgggagatgacctggcttccaccactttcagctattccagcacctggaaaagtg
gaaccgagcaaatttccatttccaaataaggactctcagctcacttcctcgggacacagt
aatccaaagaaaggtgatgctgagacagggagtccagacaatggcacgtcgaccacatca
atgctagaagatgaccttaagctaagtagcgatgaagaggagaatgaacagcaggcagcc
cagagaacggctctccacgctctgtctgacagtgccgggctcccgcaggccaactgcagg
ccctccgtgccctccagcaagggcagcagcagcggtagcagcagcagcgggagcagctcc
tccagcgactcggagagcagctcgggatctgactcagagagcgagagcagctccagcgag
agtgagggcagcaagcctccccactactccagcccggaggccgaaccagcgtcctctaac
aagtggcagctggataaatggctaaacaaagttaatccccacaagcctcctatcctgatc
caaaatgaaagccacgggccggagagcaatcaatactacaccccggtgaaggacgaagcg
ccagactgcgggaagcttcccgacaacgtctgcccgaccagcctgagagacaaggacatc
aagagcgcctgcaaggaggagcagaggccgaggaccgcgaacaaggccccggggagcaaa
ggggtgaagcagaagtccccgcctgcggccgtggccgtggccgtgaccaccgccaacgcc
ccgccgcccacggagcccgcaggcgcggacgcgctgggggcgagcgtggggatccccccg
gagccccccaagccccggccctgcggcaacagtaggaccagccaccgcaaggagctgcgc
tcggccgtaacctgcgagaagcgccgcacgcgggggctgagccggatcgtccccaaatcc
aaggagttcatcgagacggagtcgtcctcgtcgtcctcctcctcggactcggacctggag
tcggaacaggaggacttccctctgtccaaggccactgccgcctccgggagcgacccgagg
ctgaaggaggctgccaacagcatcagcgggggcggcccccgggcccctgtgggctctatc
aacgccaggaccaccagcgacatcgccaaggagctggaggagcagttctacacactggtc
cccttcggccgcaatgaacttctctccccgttgaaggacagtgacgaggtcaggtcactc
tgggtcaaaattgacctgactctcctgtccaggatcccagaacacctgccccaggagccg
ggggtcttgagcgctcccgcggccaaggacactgaaagcgcgcccccgagccacgcatct
gatgcgcccgcagaaaaggctttgccaaaatccaagaggaaacgcaagtgtgacaacgaa
gaagactacagggagatcaagaaggctcagggagagaaggagagctcttcacgactcact
gcctctgccaacagtactttgtccgcaaaccactgcaacgtgaatgtcaacagcttggcc
atcccaataaataaaaatgaaaaaatgctccggtcacccacctcacccctctccgacgca
tctaaacacaaatactccggtgaggacctgacttcccccagcagatccaacagcaatggt
ttgttcacttccgcctcctccaacaaaaagcataaggctgagaaccagctgcagacccat
ggtggagacctcacgaaagcggctcacaacaattctgaaaacaacgttctccacaagtca
cggccacagacagagccatggtctccaggctccaacggccacagggactgcaagaggcag
aaactcatcttcgatgacatgccacgcagtgcagattattttatgcaagaagctaagcga
atgaagcataaagcagatgcgatggtggaaaagtttggaaaggctctgaactatgccgaa
gcagccttgtcattcattgagtgtggaaatgcaatggagcagggcccaatggaatccaaa
tctccttatacaatgtattcagaaacagttgagctcatcagatatgctatgagactaaaa
acccactcaggccccaatgccacaccagaggataaacagctggctgcattatgttaccga
tgcctggctctcctgtactggcggatgtttcgactcaaaagggatcacgctgtaaagtat
tcaaaagcacttatcgactatttcaagaattcatctaaagctgcccaagccccatctccg
tggggggccagtggaaagagcactggcaccccatcccccatgtctcccaacccctccccc
accagctccgtgggctctcaggggagcctctccaatgggaacgccctgtccccgtcaacc
atcgtcagcatcccgcagcgcatccaccagatggcagccaaccacgtcagcatcaccaac
agcattctgcacagctatgactactgggagatggcggacaacctggccaaggagaacaga
gaattcttcaatgacctggacctgctcatggggccagtcaccctgcacagcagcatggag
cacctggtccagtactcccagcagggcctgtactggctgcggaacagcacccacctgaca
tag

DBGET integrated database retrieval system